Rv1096 Family assigned · medium auto-curated

H37Rv Rv1096 · MTBC0 mtbc0_001179 · 291 aa · 1232825–1233700 (+) · RefSeq NP_215612.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)glycosyl hydrolase
MTBC0 PGAP re-annotationpolysaccharide deacetylase family protein
Revised (this work)Polysaccharide deacetylase family protein. Pfam: Polysacc_deac_1 (PF01522.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53444 TrEMBL · unreviewed · Evidence at protein level
UniProt namePossible glycosyl hydrolase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category G Carbohydrate transport and metabolism
eggNOG descriptionpolysaccharide deacetylase
Orthologous groupCOG0726
EC number EC 3.5.1.104
KEGG orthology K22278

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Polysacc_deac_1PF01522.27 6.4e-3947–161 Polysaccharide deacetylase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: phoH2 (phosphate starvation-inducible protein PsiH), medium confidence from genomic context alone (score 621 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0696 mftF mycofactocin biosynthesis glycosyltransferase MftF 815 759 coexpression:739
Rv1095 phoH2 phosphate starvation-inducible protein PsiH 621 621 ctx neighborhood:601
Rv0236c aftD alpha-(1->3)-arabinofuranosyltransferase 503 472 coexpression:428
Rv3805c aftB terminal beta-(1->2)-arabinofuranosyltransferase 481 452 coexpression:421
Rv1406 fmt methionyl-tRNA formyltransferase 484 435
Rv3404c hyp hypothetical protein 445 392
Rv0062 celA1 cellulase CelA 509 364
Rv2164c hyp hypothetical protein 791 174 textmining:758
Rv1887 hyp hypothetical protein 659 83 textmining:644
Rv2688c antibiotic ABC transporter ATP-binding protein 553 71 textmining:539
Rv0186 bglS beta-glucosidase BglS 400 71
Rv0815c cysA2 thiosulfate sulfurtransferase CysA 451 70 textmining:435
Rv0175 Mce associated membrane protein 523 64 textmining:512
Rv3117 cysA3 thiosulfate sulfurtransferase 552 63 textmining:542
Rv0831c hyp hypothetical protein 663 55 textmining:659

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: glycosyl hydrolase
  • MTBC0 PGAP product: polysaccharide deacetylase family protein
  • Pfam (hmmscan --cut_ga): Polysacc_deac_1 PF01522.27 (E=6e-39)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215612.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Polysacc_deac_1 (PF01522.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0726
  • Curated reference: UniProt O53444 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 21 functional partner(s); context anchor phoH2
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001179|Rv1096|
MPKRPDNQTWRYWRTVTGVVVAGAVLVVGGLSGRVTRAENLSCSVIKCVALTFDDGPGPYTDRLLHILTDNDAKATFFLIGNKVAANPAGARRIADAGMEIGSHTWEHPNMTTIPPEDIPGQFSRANDVIAAATGRTPTLYRPAGGLSNDAVRQAAAKVGQAEILWDVIPFDWINDSNTAATRHMLMTQIKPGSVVLFHDTYSSTVDVVYQFIPVLKANGYRLVTVSELLGPRAPGSSYGSRENGPPVNELRDIPASEIPPLPNTSSPKPMPNFPITDIAGQNSGGPNNGA