Rv1115 Still unknown · low auto-curated

H37Rv Rv1115 · MTBC0 mtbc0_001197 · 232 aa · 1248627–1249325 (+) · RefSeq NP_215631.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Conserved hypothetical protein; no recognised domain. Function unknown. Foldseek best (non-significant) hit: 8gra-assembly1_G Structure of Type VI secretion system cargo delivery (prob 0.01, TM 0.14).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O06567 TrEMBL · unreviewed · Predicted
UniProt namePossible exported protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category M Cell wall / membrane / envelope biogenesis
eggNOG descriptionNLP P60 protein
Orthologous groupCOG0791

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 2.065 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 88.1 (confident). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
8gra-assembly1_G 0.01 0.14 7.8e+00 8gra-assembly1_G Structure of Type VI secretion system cargo delivery vehicle Hcp-VgrG-PAAR

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: vapB32 (antitoxin VapB32), medium confidence from genomic context alone (score 478 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1116 hyp hypothetical protein 515 516 ctx neighborhood:505
Rv1113 vapB32 antitoxin VapB32 478 478 ctx neighborhood:472
Rv1114 vapC32 ribonuclease VapC32 478 477 ctx neighborhood:472
Rv1111c hyp hypothetical protein 902 281 textmining:870
Rv3094c hyp hypothetical protein 516 52 textmining:511
Rv0987 adhesion component ABC transporter permease 514 50 textmining:510
Rv1500 pimF glycosyltransferase 696 47 textmining:695
Rv1811 mgtC Mg2+ transport P-type ATPase MgtC 401 46
Rv1145 mmpL13a transmembrane transport protein 512 44 textmining:511
Rv3407 vapB47 antitoxin VapB47 440 44 textmining:439
Rv3447c eccC4 ESX-4 secretion system protein EccC4 864 41 textmining:864
Rv0104 hyp hypothetical protein 803 41 textmining:803
Rv1396c PE_PGRS25 PE-PGRS family protein PE_PGRS25 652 41 textmining:652
Rv1088 PE9 PE family protein PE9 651 41 textmining:651
Rv0232 transcriptional regulator 627 41 textmining:627

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: hypothetical protein
  • Foldseek best: 8gra-assembly1_G Structure of Type VI secretion system cargo delivery vehicle Hc (prob 0.01, E=8e+00, TM=0.14)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215631.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0791
  • Curated reference: UniProt O06567 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 88.1, confident)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 17 functional partner(s); context anchor vapB32
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001197|Rv1115|
MISTTRIDFLWILSVAFASMIALATLLTLINQVVGTPYIPGGDSPAGTDCSELASWVSNAATARPVFGDRFNTGNEEAALAARGFQQGTAPNALVIGWNGHHTAVTLPDGTPVSSGEGGGVRVGGGGAYQPKFTHHMYLPMDVDAGEDQPPAPDEPVTAVDDVEPEMPAPCPTQRPPVTPRHNLCNKLRTMPGALSAALAAAAPVWPAPISGCRGFSTSLLAKRNHPVIVGK