gnd2 Resolved · high auto-curated

H37Rv Rv1122 · MTBC0 mtbc0_001205 · 340 aa · 1253569–1254591 (+) · RefSeq NP_215638.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)6-phosphogluconate dehydrogenase (decarboxylating)
MTBC0 PGAP re-annotationdecarboxylating 6-phosphogluconate dehydrogenase
Revised (this work)Decarboxylating 6-phosphogluconate dehydrogenase. Pfam: NAD_binding_2 (PF03446.22), F420_oxidored (PF03807.24), TrkA_N (PF02254.25), 6PGD (PF00393.25).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O06574 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable 6-phosphogluconate dehydrogenase,decarboxylating Gnd2

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category G Carbohydrate transport and metabolism
Preferred namegnd2
eggNOG description6-phosphogluconate dehydrogenase
Orthologous groupCOG1023
EC number EC 1.1.1.343, EC 1.1.1.44
KEGG orthology K00033
KEGG pathways map00030, map00480, map01100, map01110, map01120, map01130, map01200
KEGG modules M00004, M00006

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 2.01 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
NAD_binding_2PF03446.22 4.4e-372–155 NAD binding domain of 6-phosphogluconate dehydrogenase
F420_oxidoredPF03807.24 2.5e-053–94 NADP oxidoreductase coenzyme F420-dependent
TrkA_NPF02254.25 1.3e-046–44 TrkA-N domain
6PGDPF00393.25 2.3e-09186–214 6-phosphogluconate dehydrogenase, C-terminal domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: zwf1 (glucose-6-phosphate 1-dehydrogenase), high confidence from genomic context alone (score 980 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1121 zwf1 glucose-6-phosphate 1-dehydrogenase 984 980 ctx neighborhood:851 fusion:454 cooccurence:754
Rv1445c devB 6-phosphogluconolactonase 964 962 ctx cooccurence:577 database:900
Rv1844c gnd1 6-phosphogluconate dehydrogenase 916 916 database:900
Rv1447c zwf2 glucose-6-phosphate 1-dehydrogenase 935 910 ctx fusion:643 cooccurence:718
Rv2465c rpiB ribose-5-phosphate isomerase B 914 908 database:900
Rv1408 rpe ribulose-phosphate 3-epimerase 909 902 database:900
Rv1119c hyp hypothetical protein 520 521 ctx neighborhood:519
Rv1120c hyp hypothetical protein 519 519 ctx neighborhood:519
Rv0004 hyp hypothetical protein 708 463 ctx neighborhood:458 textmining:479
Rv0003 recF DNA replication/repair protein RecF 590 461 ctx neighborhood:458
Rv1448c tal transaldolase 515 438
Rv1118c hyp hypothetical protein 411 412 ctx neighborhood:408
Rv0729 xylB D-xylulose kinase XylB 448 374
Rv3673c membrane-anchored thioredoxin-like protein 662 55 textmining:658
Rv0542c menE 2-succinylbenzoic acid--CoA ligase 661 54 textmining:657

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 6-phosphogluconate dehydrogenase (decarboxylating)
  • MTBC0 PGAP product: decarboxylating 6-phosphogluconate dehydrogenase
  • Pfam (hmmscan --cut_ga): NAD_binding_2 PF03446.22 (E=4e-37), F420_oxidored PF03807.24 (E=3e-05), TrkA_N PF02254.25 (E=1e-04), 6PGD PF00393.25 (E=2e-09)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215638.1)
  • Domains: Pfam-A via hmmscan --cut_ga — NAD_binding_2 (PF03446.22), F420_oxidored (PF03807.24), TrkA_N (PF02254.25), 6PGD (PF00393.25)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1023
  • Curated reference: UniProt O06574 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 26 functional partner(s); context anchor zwf1
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001205|Rv1122|gnd2
MQLGMIGLGRMGANIVRRLAKGGHDCVVYDHDPDAVKAMAGEDRTTGVASLRELSQRLSAPRVVWVMVPAGNITTAVIEELANTLEAGDIVIDGGNTYYRDDLRHEKLLFKKGIHLLDCGTSGGVWGRERGYCLMIGGDGDAFARAEPIFATVAPGVAAAPRTPGRDGEVAPSEQGYLHCGPCGSGHFVKMVHNGIEYGMMASLAEGLNILRNADVGTRVQHGDAETAPLPNPECYQYDFDIPEVAEVWRRGSVIGSWLLDLTAIALRESPDLAEFSGRVSDSGEGRWTAIAAIDEGVPAPVLTTALQSRFASRDLDDFANKALSAMRKQFGGHAEKPAN