xseA Family assigned · medium auto-curated

H37Rv Rv1108c · MTBC0 mtbc0_001190 · 415 aa · 1242653–1243900 (-) · RefSeq NP_215624.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)exodeoxyribonuclease VII large subunit
MTBC0 PGAP re-annotationexodeoxyribonuclease VII large subunit
Revised (this work)Exodeoxyribonuclease VII large subunit. Pfam: tRNA_anti_2 (PF13742.13), Exonuc_VII_L (PF02601.21).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WF31 SwissProt · reviewed · Evidence at protein level
UniProt nameExodeoxyribonuclease 7 large subunit
EC (curated) EC 3.1.11.6
Curated functionBidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category L Replication, recombination and repair
Preferred namexseA
eggNOG descriptionBidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides
Orthologous groupCOG1570
EC number EC 3.1.11.6
KEGG orthology K03601
KEGG pathways map03430
Gene Ontology (6) GO:0005575, GO:0005618, GO:0005623, GO:0030312, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.315 · purifying
Polymorphic sites (≥ 0.1% of strains) 6 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
tRNA_anti_2PF13742.13 3.2e-1412–105 OB-fold nucleic acid binding domain
Exonuc_VII_LPF02601.21 9.3e-62128–342 Exonuclease VII, large subunit

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: xseB (exodeoxyribonuclease VII small subunit), high confidence from genomic context alone (score 999 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1107c xseB exodeoxyribonuclease VII small subunit 999 999 ctx neighborhood:882 coexpression:890 experimental:474 database:900 textmining:622
Rv1109c hyp hypothetical protein 886 886 ctx neighborhood:882
Rv1106c 3 beta-hydroxysteroid dehydrogenase/delta 5-->4-isomerase 883 883 ctx neighborhood:882
Rv1110 lytB2 4-hydroxy-3-methylbut-2-enyl diphosphate reductase 788 787 ctx neighborhood:782
Rv3356c folD bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase 671 671 coexpression:590
Rv0639 nusG transcription termination/antitermination protein NusG 605 587 coexpression:587
Rv1709 scpA segregation and condensation protein ScpA 462 463
Rv1407 fmu 16S rRNA m5C967 methyltransferase 462 462
Rv2883c pyrH uridylate kinase 453 454 coexpression:423
Rv1650 pheT phenylalanine--tRNA ligase subunit beta 446 446
Rv0562 grcC1 polyprenyl-diphosphate synthase GrcC 455 424 coexpression:405
Rv2173 idsA2 geranylgeranyl pyrophosphate synthetase IdsA 453 422 coexpression:403
Rv3383c idsB polyprenyl synthetase IdsB 452 421 coexpression:402
Rv3398c idsA1 multifunctional dimethylallyltransferase/geranyltranstransferase/farnesyltranstransferase 452 421 coexpression:402
Rv0989c grcC2 polyprenyl-diphosphate synthase GrcC 449 417

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: exodeoxyribonuclease VII large subunit
  • MTBC0 PGAP product: exodeoxyribonuclease VII large subunit
  • Pfam (hmmscan --cut_ga): tRNA_anti_2 PF13742.13 (E=3e-14), Exonuc_VII_L PF02601.21 (E=9e-62)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215624.1)
  • Domains: Pfam-A via hmmscan --cut_ga — tRNA_anti_2 (PF13742.13), Exonuc_VII_L (PF02601.21)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1570
  • Curated reference: UniProt P9WF31 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 51 functional partner(s); context anchor xseB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001190|Rv1108c|xseA
MTQNSAENPFPVRAVAIRVAGWIDKLGAVWVEGQLAQITMRPDAKTVFMVLRDPAADMSLTVTCSRDLVLSAPVKLAEGVQVVVCGKPSFYTGRGTFSLRLSEIRAVGIGELLARIDRLRRLLDAEGLFDPRLKRPIPYLPNMIGLITGRASAAERDVTTVASARWPAARFAVRNVAVQGPNAVGQIVEALRELDRDPDVDVIVLARGGGSVEDLLPFSDETLCRAIAACRTPVVSAVGHEPDNPLCDLVVDLRAATPTDAAKKVVPDTAAEQRLIDDLRRRSAQALRNWVSREQRAVAQLRSRPVLADPMTMVSVRAEEVHRARSTLRRNLTLMVAAETERIGHLAARLATLGPAATLARGYAIVQTVAQTGPEGGSEPQVLRSVHDAPEGTKLRVRVADGALAAVSEGQTNGL