vapB4 Resolved · high auto-curated

H37Rv Rv0596c · MTBC0 mtbc0_000626 · 85 aa · 698780–699037 (-) · RefSeq NP_215110.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)antitoxin VapB4
MTBC0 PGAP re-annotationtype II toxin-antitoxin system antitoxin VapB4
Revised (this work)Type II toxin-antitoxin system antitoxin VapB4. Pfam: PhdYeFM_antitox (PF02604.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WF21 SwissProt · reviewed · Evidence at protein level
UniProt nameAntitoxin VapB4
Curated functionAntitoxin component of a type II toxin-antitoxin (TA) system. Antitoxin that counteracts the effect of its cognate VapC4 toxin. Upon expression in situ, in M.smegmatis or E.coli neutralizes the effect of cognate toxin VapC4.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category D Cell cycle control, cell division, chromosome partitioning
eggNOG descriptionAntitoxin component of a toxin-antitoxin (TA) module
Orthologous groupCOG4118
Gene Ontology (10) GO:0003674, GO:0005488, GO:0005515, GO:0008150, GO:0040008, GO:0045927, GO:0048518, GO:0050789, GO:0065007, GO:0097351

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.365 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 0 missense, 1 nonsense, 0 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.32% of strains (458) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PhdYeFM_antitoxPF02604.27 2.1e-093–49 Antitoxin Phd_YefM, type II toxin-antitoxin system

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: vapC4 (ribonuclease VapC4), high confidence from genomic context alone (score 956 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0595c vapC4 ribonuclease VapC4 985 956 ctx neighborhood:801 experimental:784 textmining:672
Rv0627 vapC5 ribonuclease VapC5 805 797 experimental:784
Rv0665 vapC8 ribonuclease VapC8 804 796 experimental:784
Rv1953 vapC14 ribonuclease VapC14 529 529 experimental:513
Rv0597c hyp hypothetical protein 487 488 ctx neighborhood:485
Rv0598c vapC27 ribonuclease VapC27 514 306
Rv0549c vapC3 ribonuclease VapC3 449 72 textmining:431
Rv0624 vapC30 ribonuclease VapC30 428 69 textmining:411
Rv3180c vapC49 ribonuclease VapC45 528 64 textmining:517
Rv3408 vapC47 ribonuclease VapC47 522 62 textmining:512
Rv0661c vapC7 ribonuclease VapC7 444 61 textmining:433
Rv1838c vapC13 ribonuclease VapC13 449 59 textmining:439
Rv2863 vapC23 ribonuclease VapC23 631 58 textmining:625
Rv2494 vapC38 ribonuclease VapC38 448 58 textmining:439
Rv2871 vapB43 antitoxin VapB43 445 49 textmining:441

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: antitoxin VapB4
  • MTBC0 PGAP product: type II toxin-antitoxin system antitoxin VapB4
  • Pfam (hmmscan --cut_ga): PhdYeFM_antitox PF02604.27 (E=2e-09)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215110.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PhdYeFM_antitox (PF02604.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG4118
  • Curated reference: UniProt P9WF21 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 20 functional partner(s); context anchor vapC4
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000626|Rv0596c|vapB4
MSATIPARDLRNHTAEVLRRVAAGEEIEVLKDNRPVARIVPLKRRRQWLPAAEVIGELVRLGPDTTNLGEELRETLTQTTDDVRW