vapB4 Resolved · high auto-curated
H37Rv Rv0596c · MTBC0 mtbc0_000626 ·
85 aa ·
698780–699037 MTBC0
(-) ·
RefSeq NP_215110.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | antitoxin VapB4 |
|---|---|
| MTBC0 PGAP re-annotation | type II toxin-antitoxin system antitoxin VapB4 |
| Revised (this work) | Type II toxin-antitoxin system antitoxin VapB4. Pfam: PhdYeFM_antitox (PF02604.27). |
| Functional category (TubercuList) | virulence, detoxification, adaptation |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 2 publications
2 TB publications mention this gene. 2 publication(s) discuss this gene (2 in a M. tuberculosis context, 1 in other mycobacteria — M. smegmatis (1)).
| Publication | Date |
|---|---|
| Structure-function analysis of VapB4 antitoxin identifies critical features of a minimal VapC4 toxin-binding module. doi:10.1128/JB.02508-14 | 2015 |
| Growth and translation inhibition through sequence-specific RNA binding by Mycobacterium tuberculosis VapC toxin. doi:10.1074/jbc.M112.340109 | 2012 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 2 % of gene
| Neighbour | Rv0595c (Rv0595c, - strand) |
|---|---|
| Overlap | 4 bp, 2 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
Conditional expression context (iModulons)
Member of 1 independently-modulated gene set(s):
Positive Regulation of Growth.
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
CRISPRi vulnerability
Vulnerability index -0.15 (95% CI -1.35 to 1.30). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb0612c
· 100.0% identity |
|---|---|
| M. orygis |
RJtmp_000625
· 100.0% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WF21
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Antitoxin VapB4 |
| Curated function | Antitoxin component of a type II toxin-antitoxin (TA) system. Antitoxin that counteracts the effect of its cognate VapC4 toxin. Upon expression in situ, in M.smegmatis or E.coli neutralizes the effect of cognate toxin VapC4. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
D Cell cycle control, cell division, chromosome partitioning
|
|---|---|
| eggNOG description | Antitoxin component of a toxin-antitoxin (TA) module |
| Orthologous group | COG4118 |
| Gene Ontology (10) |
GO:0003674, GO:0005488, GO:0005515, GO:0008150, GO:0040008, GO:0045927, GO:0048518, GO:0050789, GO:0065007, GO:0097351
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.365 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 0 missense, 1 nonsense, 0 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.32% of strains (458) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Mycobacterium
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 1 consensus substitution(s) low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 19/53 (36%) · mean identity 45.3%
· 3/4 closest MTBAP relatives present in a subset of the genus (19/53 NTM; in 3 of the 4 closest MTBAP relatives) — partial/intermediate conservation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria short ORF (85 aa) a shallow stratum may reflect homology-detection failure, not true youth present across the genus Mycobacterium (NTM) but not detected in any non-Mycobacterium genome — a Mycobacterium-genus gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 5 in the ORF — 0 in the essential state, 0 growth-defect, 5 non-essential, 0 growth-advantage. Saturation 0.600, mean read count 34.3333333333. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Read with some caution: only 5 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 5 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 7 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 12.4 ppm · rank 2587/3519 (26.5th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 85 aa |
|---|---|
| Molecular weight | 9.7 kDa |
| Theoretical pI | 6.59 |
| GRAVY | -0.511 (hydrophilic) |
| Aliphatic index | 100.9 |
| Aromaticity | 0.024 |
| Instability index | 74.3 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
PhdYeFM_antitox | PF02604.27 | 2.1e-09 | 3–49 | Antitoxin Phd_YefM, type II toxin-antitoxin system |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 91.6
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
6jqy-assembly1_A |
1.00 | 0.91 | 4.9e-04 sig | 6jqy-assembly1_A Crystal structure of N-terminal domain of VapB46 antitoxin from Mycobacterium tuberculosis |
3hs2-assembly4_H |
1.00 | 0.63 | 9.8e-03 sig | 3hs2-assembly4_H Crystal structure of PHD truncated to residue 57 in an orthorhombic space group |
3g5o-assembly1_D |
1.00 | 0.49 | 5.7e-03 sig | 3g5o-assembly1_D The crystal structure of the toxin-antitoxin complex RelBE2 (Rv2865-2866) from Mycobacterium tuberculosis |
Foldseek search of the AlphaFold DB model (mean pLDDT 91.6, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 2
| Upstream (5' on genome) | vapC4 (- strand, -4 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv0597c (- strand, 182 bp gap) |
| Predicted operon |
vapC4 · vapB4
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: vapC4 (ribonuclease VapC4), high confidence from genomic context alone (score 956 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0595c vapC4 exp |
ribonuclease VapC4 | 985 | 956 ctx | neighborhood:801 experimental:784 textmining:672 |
Rv0627 vapC5 exp |
ribonuclease VapC5 | 805 | 797 | experimental:784 |
Rv0665 vapC8 exp |
ribonuclease VapC8 | 804 | 796 | experimental:784 |
Rv1953 vapC14 exp |
ribonuclease VapC14 | 529 | 529 | experimental:513 |
Rv0597c hyp |
hypothetical protein | 487 | 488 ctx | neighborhood:485 |
Rv0598c vapC27 |
ribonuclease VapC27 | 514 | 306 | |
Rv0549c vapC3 |
ribonuclease VapC3 | 449 | 72 | textmining:431 |
Rv0624 vapC30 |
ribonuclease VapC30 | 428 | 69 | textmining:411 |
Rv3180c vapC49 |
ribonuclease VapC45 | 528 | 64 | textmining:517 |
Rv3408 vapC47 |
ribonuclease VapC47 | 522 | 62 | textmining:512 |
Rv0661c vapC7 |
ribonuclease VapC7 | 444 | 61 | textmining:433 |
Rv1838c vapC13 |
ribonuclease VapC13 | 449 | 59 | textmining:439 |
Rv2863 vapC23 |
ribonuclease VapC23 | 631 | 58 | textmining:625 |
Rv2494 vapC38 |
ribonuclease VapC38 | 448 | 58 | textmining:439 |
Rv2871 vapB43 |
antitoxin VapB43 | 445 | 49 | textmining:441 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: antitoxin VapB4
- MTBC0 PGAP product: type II toxin-antitoxin system antitoxin VapB4
- Pfam (hmmscan --cut_ga): PhdYeFM_antitox PF02604.27 (E=2e-09)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215110.1)
- Domains: Pfam-A via hmmscan --cut_ga — PhdYeFM_antitox (PF02604.27)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG4118 - Curated reference: UniProt P9WF21 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 91.6)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
20 functional partner(s); context anchor
vapC4 - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000626|Rv0596c|vapB4 MSATIPARDLRNHTAEVLRRVAAGEEIEVLKDNRPVARIVPLKRRRQWLPAAEVIGELVRLGPDTTNLGEELRETLTQTTDDVRW
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for vapB4? Email the maintainer — the message is pre-filled with this gene's details.