Rv0615 Family assigned · medium

H37Rv Rv0615 · MTBC0 mtbc0_000647 · 80 aa · 713897–714139 MTBC0 (+) · RefSeq NP_215129.1

Genomic neighbourhood (genome browser)

Open in full genome browser →
+ strand − strand Rv0603 (Rv0603) — family_assigned: hypothetical protein lpqO (Rv0604) — family_assigned: DUF1259 domain-containing protein lpqO Rv0605 (Rv0605) — family_assigned: IS607-like element IS1536 family transposase vapB28 (Rv0608) — family_assigned: type II toxin-antitoxin system VapB family antitoxin vapC28 (Rv0609) — family_assigned: type II toxin-antitoxin system VapC family toxin Rv0610c (Rv0610c) — family_assigned: hypothetical protein Rv0610c Rv0611c (Rv0611c) — family_assigned: DUF4926 domain-containing protein Rv0612 (Rv0612) — family_assigned: hypothetical protein Rv0613c (Rv0613c) — family_assigned: SEC-C domain-containing protein Rv0613c Rv0614 (Rv0614) — dark: hypothetical protein Rv0615 (Rv0615) — family_assigned: hypothetical protein vapC29 (Rv0617) — requalified: type II toxin-antitoxin system ribonuclease VapC29 galK (Rv0620) — requalified: galactokinase galK Rv0622 (Rv0622) — dark: DUF732 domain-containing protein Rv0622 vapB30 (Rv0623) — requalified: type II toxin-antitoxin system antitoxin VapB30 vapC30 (Rv0624) — requalified: type II toxin-antitoxin system toxin ribonuclease C30 Rv0625c (Rv0625c) — family_assigned: TVP38/TMEM64 family protein vapB5 (Rv0626) — family_assigned: type II toxin-antitoxin system Phd/YefM family antitoxin vapC5 (Rv0627) — family_assigned: type II toxin-antitoxin system VapC family toxin Rv0628c (Rv0628c) — family_assigned: FIST N-terminal domain-containing protein Rv0628c recD (Rv0629c) — family_assigned: exodeoxyribonuclease V subunit alpha recD recB (Rv0630c) — family_assigned: exodeoxyribonuclease V subunit beta 704 kb 708 kb 712 kb 716 kb 720 kb 724 kb

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)integral membrane protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Small integral membrane protein, candidate accessory subunit of the mycobacterial respiratory cytochrome bcc:aa3 supercomplex: its fold matches actinobacterial supercomplex membrane subunits (HHpred, the strongest of this set: 7Q21 Cgl2017 / 7E1V, E~0.24) and it is under strong purifying selection (pN/pS 0.2). CAVEAT: structural-fold candidacy ONLY; no genomic, co-expression or structural-modelling corroboration that it is a bona fide subunit.
Functional category (TubercuList)cell wall and cell processes

In the literature (TB corpus sweep) never studied

No publication mentions this gene in its title or abstract — not under its H37Rv locus tag, not under its gene name, and not under any ortholog identifier. Its annotation rests on sequence/structure evidence, with no primary study behind it.

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Genomic-neighbour overlap (structural caveat) co-directional · 2 % of gene

NeighbourRv0614 (Rv0614, + strand)
Overlap4 bp, 2 % of this gene's length

co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.

CRISPRi vulnerability

Vulnerability index 0.21 (95% CI -1.10 to 2.00). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb0632 · 100.0% identity
M. orygis RJtmp_000646 · 100.0% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt O07762 TrEMBL · unreviewed · Predicted
UniProt nameProbable integral membrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2B4W7

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.2 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Mycobacterium

M. canettii dN/dS (deep-divergence selection) 0.0 (low power) · 1 consensus substitution(s)
low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 7/53 (13%) · mean identity 69.4% · 1/4 closest MTBAP relatives
present in a subset of the genus (7/53 NTM; in 1 of the 4 closest MTBAP relatives) — partial/intermediate conservation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria

short ORF (80 aa) a shallow stratum may reflect homology-detection failure, not true youth
present across the genus Mycobacterium (NTM) but not detected in any non-Mycobacterium genome — a Mycobacterium-genus gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 5 in the ORF — 0 in the essential state, 0 growth-defect, 5 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 150.6. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.
CaveatRead with some caution: only 5 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 5 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3)

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype

Conditionlog2FCqEffect
fitness in mouse infection (in vivo) -1.070.033 required

Conditional fitness of transposon-disruption mutants across 1 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.

Proteomics (mass spectrometry) not detected

Not detected in the mass-spectrometry datasets integrated by PaxDb. This is not evidence of absence: low-abundance, condition-specific, or MS-refractory proteins (e.g. small, highly hydrophobic, or repetitive PE/PPE families with few tryptic peptides) are systematically under-sampled.

Predicted localisation (DeepTMHMM + lipobox)

Predictionpredicted membrane protein (3 TM helixes)
DeepTMHMM classTM
TM helices (DeepTMHMM)3

Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.

Physico-chemical properties (computed, ProtParam)

Length80 aa
Molecular weight8.3 kDa
Theoretical pI10.74
GRAVY0.92 (hydrophobic)
Aliphatic index130.6
Aromaticity0.062
Instability index24.7 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Genomic context (neighbours & predicted operon) operon of 2

Upstream (5' on genome)Rv0614 (+ strand, -4 bp gap)
Downstream (3' on genome)vapB29 (+ strand, 194 bp gap)
Predicted operon Rv0614 · Rv0615

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0614 hyp hypothetical protein 883 883 ctx neighborhood:882
Rv0613c hyp hypothetical protein 573 573 ctx neighborhood:572

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • HHpred (Neff 1.94): 5/5 top hits to respiratory-supercomplex membrane proteins (7E1V PRSAF1 M.smegmatis/M.tb 82%; 9GY6 cytochrome bc mycobacterial 89%; 7Q21 Corynebacterium supercomplex 89%); DeepTMHMM transmembrane; strong purifying
  • HHpred web (MPI Bioinformatics Toolkit, profile-profile remote homology), interpreted in project 'Still unknown gene function', 2026-06-10. A fold/family-level assignment, not a demonstrated function.
  • Case-study refutation (2026-06-12): the 5 small dark membrane/lipoproteins originally flagged as supercomplex subunits are dispersed (0.4-3.2 Mb), none near qcrCAB(Rv2194-6)/ctaCDE, STRING anchors are genomic neighbours (regulators/methyltransferases) NOT respiratory genes, and no literature/structure models them as subunits -> fold resemblance only, NOT a validated functional module.

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215129.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2B4W7
  • Curated reference: UniProt O07762 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 81.0)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 2 functional partner(s)
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000647|Rv0615|
MMDVLAAGIAAGALTLAAWGAWRPHYRAASYLVAGAVELALIGLLVVTGQTLMAISVAFLVALGGPLVVVNHRRAERSRG