vapC29 Resolved · high auto-curated

H37Rv Rv0617 · MTBC0 mtbc0_000650 · 133 aa · 714558–714959 (+) · RefSeq NP_215131.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ribonuclease VapC29
MTBC0 PGAP re-annotationtype II toxin-antitoxin system ribonuclease VapC29
Revised (this work)Type II toxin-antitoxin system ribonuclease VapC29. Pfam: PIN (PF01850.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WF79 SwissProt · reviewed · Evidence at protein level
UniProt nameRibonuclease VapC29
EC (curated) EC 3.1.-.-
Curated functionToxic component of a type II toxin-antitoxin (TA) system. Its cognate antitoxin is VapB29 (By similarity). Has ribonuclease activity.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionToxic component of a toxin-antitoxin (TA) module. An RNase
Orthologous groupCOG1848
KEGG orthology K07064

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.349 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PINPF01850.28 6.7e-143–121 PIN domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: vapB29 (antitoxin VapB29), high confidence from genomic context alone (score 801 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0616A vapB29 antitoxin VapB29 906 801 ctx neighborhood:801 textmining:548
Rv0616c Hypothetical protein; Rv0616c, (MTCY19H5.05), len: 88 aa. Hypothetical unknown protein. 580 579 ctx neighborhood:577
Rv0618 galTa Rv0618, (MTCY19H5.03c), len: 231 aa (probable partial CDS). Probable galTa, first part of galactose-1-phosphate uridylyltransferase, highly 514 514 ctx neighborhood:508
Rv0619 galTb Rv0619, (MTCY19H5.02c), len: 181 aa (probable partial CDS). Probable galTb, second part of galactose-1-phosphate uridylyltransferase, highly 510 511 ctx neighborhood:508
Rv2018 vapB45 hyp hypothetical protein 505 506 ctx cooccurence:502
Rv0620 galK galactokinase 499 500 ctx neighborhood:500
Rv1114 vapC32 ribonuclease VapC32 878 409 ctx cooccurence:403 textmining:803
Rv2871 vapB43 antitoxin VapB43 406 407
Rv0748 vapB31 antitoxin VapB31 402 403
Rv0624 vapC30 ribonuclease VapC30 563 303
Rv2010 vapC15 ribonuclease VapC15 719 218 textmining:656
Rv0609 vapC28 ribonuclease VapC28 833 191 textmining:803
Rv2548 vapC19 ribonuclease VapC19 761 185 textmining:720
Rv0065 vapC1 ribonuclease VapC1 830 183 textmining:801
Rv1561 vapC11 ribonuclease VapC11 832 170 textmining:807

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ribonuclease VapC29
  • MTBC0 PGAP product: type II toxin-antitoxin system ribonuclease VapC29
  • Pfam (hmmscan --cut_ga): PIN PF01850.28 (E=7e-14)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215131.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PIN (PF01850.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1848
  • Curated reference: UniProt P9WF79 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 28 functional partner(s); context anchor vapB29
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000650|Rv0617|vapC29
MTVLLDANVLIALVVAEHVHHDAAADWLMASDTGFATCPMTQGSLVRFLVRSGQSAAAARDVVSAVQCTSRHEFWPDALSFAGVEVAGVVGHRQVTDAYLAQLARSHDGQLATLDSGLAHLHGDVAVLIPTTT