Rv0600c Resolved · high auto-curated

H37Rv Rv0600c · MTBC0 - · 168 aa · 697904–698410 (-) · RefSeq NP_215114.2

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)two component sensor kinase HK1
MTBC0 PGAP re-annotation
Revised (this work)Two component sensor kinase HK1. Pfam: HATPase_c (PF02518.32).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt O07778 SwissProt · reviewed · Evidence at protein level
UniProt nameSensor histidine kinase component HK1
EC (curated) EC 2.7.13.3
Curated functionMember of the three-protein two-component system HK1/HK2/TcrA. Kinase that binds ATP and catalyzes the transfer of a phosphoryl group from ATP to HK2.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category T Signal transduction mechanisms
eggNOG descriptionHistidine kinase
Orthologous groupCOG0642

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.36 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
HATPase_cPF02518.32 6.7e-2534–140 Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: tcrA (two component DNA binding transcriptional regulator TcrA), high confidence from genomic context alone (score 938 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0602c tcrA two component DNA binding transcriptional regulator TcrA 970 938 ctx neighborhood:441 cooccurence:762 textmining:541
Rv0903c prrA two component transcriptional regulator PrrA 914 897 ctx cooccurence:766
Rv3246c mtrA two component DNA-binding response regulator MtrA 912 897 ctx cooccurence:767
Rv0491 regX3 two component sensory transduction protein RegX 900 896 ctx cooccurence:765
Rv0981 mprA two-component response regulator MrpA 896 892 ctx cooccurence:756
Rv1033c trcR two component transcriptional regulator TrcR 913 891 ctx cooccurence:755
Rv0757 phoP two component system response transcriptional positive regulator PhoP 895 891 ctx cooccurence:753
Rv3765c tcrX two component transcriptional regulator TcrX 911 887 ctx cooccurence:746
Rv2884 transcriptional regulator 877 872 ctx cooccurence:710
Rv1027c kdpE transcriptional regulator KdpE 892 871 ctx cooccurence:707
Rv0601c two component sensor kinase HK2 947 864 ctx neighborhood:511 experimental:500 textmining:630
Rv0818 transcriptional regulator 809 801 ctx cooccurence:548
Rv1248c kgd multifunctional 2-oxoglutarate dehydrogenase E1 component /2-oxoglutarate dehydrogenase dihydrolipoyllysine-residue succinyltransferase 758 728 experimental:422 database:538
Rv2496c bkdB 3-methyl-2-oxobutanoate dehydrogenase subunit beta 742 728 database:590
Rv1734c hyp hypothetical protein 727 716 experimental:401 database:538

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): two component sensor kinase HK1
  • Pfam (hmmscan --cut_ga): HATPase_c PF02518.32 (E=7e-25)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215114.2)
  • Domains: Pfam-A via hmmscan --cut_ga — HATPase_c (PF02518.32)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0642
  • Curated reference: UniProt O07778 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 61 functional partner(s); context anchor tcrA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0600c|
MPITPLLHESVARFAATGADITTRAEPDLFVSIDPDHLRRILTAVLDNAITHGDGEIAVTAHARDGAVDIGVRDHGPGFADHFLPVAFDRFTRADTARGGRGSGLGLAIVAALTTTHGGHANATNHPDGGAELRITLPTPRPPFHEELPRITSSDTKDPNREHDTSDQ