Rv0601c Resolved · high auto-curated

H37Rv Rv0601c · MTBC0 - · 156 aa · 698524–698994 (-) · RefSeq NP_215115.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)two component sensor kinase HK2
MTBC0 PGAP re-annotation
Revised (this work)Two component sensor kinase HK2. Pfam: HAMP (PF00672.31).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt O07777 SwissProt · reviewed · Evidence at protein level
UniProt nameSensor histidine kinase component HK2
EC (curated) EC 2.7.13.3
Curated functionMember of the three-protein two-component system HK1/HK2/TcrA. HK2 transfers its phosphoryl group to TcrA.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category T Signal transduction mechanisms
Preferred nameyclK
eggNOG descriptionHistidine kinase
Orthologous groupCOG2972
EC number EC 2.7.13.3, EC 4.6.1.1
KEGG orthology K01768, K02484, K07653, K11617, K17292
KEGG pathways map00230, map02020, map02025, map04113, map04213
KEGG modules M00460, M00481, M00695, M00754
Gene Ontology (63) GO:0000155, GO:0000160, GO:0003674, GO:0003824, GO:0004672, GO:0004673, GO:0005488, GO:0005515, GO:0006464, GO:0006468, GO:0006793, GO:0006796 +51 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 0 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.10% of strains (150) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
HAMPPF00672.31 8.8e-1261–116 HAMP domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: tcrA (two component DNA binding transcriptional regulator TcrA), high confidence from genomic context alone (score 967 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0602c tcrA two component DNA binding transcriptional regulator TcrA 987 967 ctx neighborhood:700 cooccurence:616 coexpression:606 textmining:644
Rv0600c two component sensor kinase HK1 947 864 ctx neighborhood:511 experimental:500 textmining:630
Rv0981 mprA two-component response regulator MrpA 746 737 ctx cooccurence:404
Rv1033c trcR two component transcriptional regulator TrcR 784 730
Rv1248c kgd multifunctional 2-oxoglutarate dehydrogenase E1 component /2-oxoglutarate dehydrogenase dihydrolipoyllysine-residue succinyltransferase 758 729 experimental:422 database:538
Rv2496c bkdB 3-methyl-2-oxobutanoate dehydrogenase subunit beta 741 727 database:590
Rv2215 dlaT pyruvate dehydrogenase E2 component dihydrolipoamide acyltransferase 734 724 experimental:401 database:538
Rv0757 phoP two component system response transcriptional positive regulator PhoP 727 717
Rv2495c bkdC branched-chain keto acid dehydrogenase E2 component 724 713 experimental:401 database:538
Rv1734c hyp hypothetical protein 724 713 experimental:401 database:538
Rv1017c prsA ribose-phosphate pyrophosphokinase 712 696 database:586
Rv0648 alpha-mannosidase 691 692 coexpression:692
Rv3765c tcrX two component transcriptional regulator TcrX 752 689
Rv0903c prrA two component transcriptional regulator PrrA 739 689
Rv0603 hyp hypothetical protein 675 675 ctx neighborhood:514

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): two component sensor kinase HK2
  • Pfam (hmmscan --cut_ga): HAMP PF00672.31 (E=9e-12)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215115.1)
  • Domains: Pfam-A via hmmscan --cut_ga — HAMP (PF00672.31)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2972
  • Curated reference: UniProt O07777 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 61 functional partner(s); context anchor tcrA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0601c|
MALVLAAAGAVTVVQFRDAAHEADPDGALRGLTDDITADLVRELVTILPIVLVIAAVAAYLLSRAALRPVDRIRAAAQTLTTTPHPDTDAPLPVPPTDDEIAWLATTLNTMLTRLQRALAHEQQFVADASHELRTPLALLTTELELRCAGPDPPTS