Rv0502 Family assigned · medium auto-curated

H37Rv Rv0502 · MTBC0 mtbc0_000530 · 358 aa · 596132–597208 (+) · RefSeq NP_215016.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationlysophospholipid acyltransferase family protein
Revised (this work)Lysophospholipid acyltransferase family protein. Pfam: Acyltransferase (PF01553.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WKT1 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv0502

UniProt still lists this protein as Uncharacterized protein Rv0502; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
eggNOG descriptionAcyltransferase
Orthologous groupCOG0204
Gene Ontology (6) GO:0005575, GO:0005623, GO:0005886, GO:0016020, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
AcyltransferasePF01553.27 6.3e-22129–260 Acyltransferase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: galE2 (UDP-glucose 4-epimerase GalE), high confidence from genomic context alone (score 970 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0501 galE2 UDP-glucose 4-epimerase GalE 970 970 ctx neighborhood:882 cooccurence:742
Rv0500B Rv0500B, len: 33 aa. Conserved hypothetical protein. Basic protein 18 of the 33 aa are Arg or Lys, with strong similarity to AL079345|SCE68_ 789 789 ctx neighborhood:787
Rv2185c TB16.3 hyp hypothetical protein 724 724 ctx cooccurence:720
Rv0854 hyp hypothetical protein 677 678 ctx cooccurence:675
Rv0474 HTH-type transcriptional regulator 676 677 ctx cooccurence:672
Rv3680 anion transporter ATPase 668 668 ctx cooccurence:653
Rv0857 hyp hypothetical protein 668 668 ctx cooccurence:667
Rv3679 anion transporter ATPase 624 624 ctx cooccurence:619
Rv3233c Rv3233c, (MTCY20B11.08c), len: 196 aa. Possible triacylglycerol synthase (See Daniel et al., 2004), similar to C-terminus of Q9RIU8|SCM11.13 605 605 ctx cooccurence:546
Rv3197 ABC transporter ATP-binding protein 574 574 ctx cooccurence:567
Rv3234c tgs3 diacyglycerol O-acyltransferase 549 550 ctx cooccurence:482
Rv0425c ctpH metal cation transporting ATPase H 471 470 database:451
Rv0107c ctpI cation-transporter ATPase I 467 466 database:451
Rv1997 ctpF cation transporter ATPase F 467 466 database:451
Rv0908 ctpE metal cation transporter ATPase E 465 465 database:451

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: lysophospholipid acyltransferase family protein
  • Pfam (hmmscan --cut_ga): Acyltransferase PF01553.27 (E=6e-22)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215016.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Acyltransferase (PF01553.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0204
  • Curated reference: UniProt P9WKT1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 22 functional partner(s); context anchor galE2
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000530|Rv0502|
MGNVAGETRANVIPLHTNRSRVAARRRAGQRAESRQHPSLLSDPNDRASAEQIAAVVREIDEHRRAAGATTSSTEATPNDLAQLVAAVAGFLRQRLTGDYSVDEFGFDPHFNSAIVRPLLRFFFKSWFRVEVSGVENIPRDGAALVVANHAGVLPFDGLMLSVAVHDEHPAHRDLRLLAADMVFDLPVIGEAARKAGHTMACTTDAHRLLASGELTAVFPEGYKGLGKRFEDRYRLQRFGRGGFVSAALRTKAPIVPCSIIGSEEIYPMLTDVKLLARLFGLPYFPITPLFPLAGPVGLVPLPSKWRIAFGEPICTADYASTDADDPMVTFELTDQVRETIQQTLYRLLAGRRNIFFG