Rv0502 Family assigned · medium auto-curated
H37Rv Rv0502 · MTBC0 mtbc0_000530 ·
358 aa · 596132–597208 (+) ·
RefSeq NP_215016.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | lysophospholipid acyltransferase family protein |
| Revised (this work) | Lysophospholipid acyltransferase family protein. Pfam: Acyltransferase (PF01553.27). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WKT1
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Uncharacterized protein Rv0502 |
UniProt still lists this protein as Uncharacterized protein Rv0502; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
I Lipid transport and metabolism
|
|---|---|
| eggNOG description | Acyltransferase |
| Orthologous group | COG0204 |
| Gene Ontology (6) |
GO:0005575, GO:0005623, GO:0005886, GO:0016020, GO:0044464, GO:0071944
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.0 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 0 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Acyltransferase | PF01553.27 | 6.3e-22 | 129–260 | Acyltransferase |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: galE2 (UDP-glucose 4-epimerase GalE), high confidence from genomic context alone (score 970 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0501 galE2 |
UDP-glucose 4-epimerase GalE | 970 | 970 ctx | neighborhood:882 cooccurence:742 |
Rv0500B |
Rv0500B, len: 33 aa. Conserved hypothetical protein. Basic protein 18 of the 33 aa are Arg or Lys, with strong similarity to AL079345|SCE68_ | 789 | 789 ctx | neighborhood:787 |
Rv2185c TB16.3 hyp |
hypothetical protein | 724 | 724 ctx | cooccurence:720 |
Rv0854 hyp |
hypothetical protein | 677 | 678 ctx | cooccurence:675 |
Rv0474 |
HTH-type transcriptional regulator | 676 | 677 ctx | cooccurence:672 |
Rv3680 |
anion transporter ATPase | 668 | 668 ctx | cooccurence:653 |
Rv0857 hyp |
hypothetical protein | 668 | 668 ctx | cooccurence:667 |
Rv3679 |
anion transporter ATPase | 624 | 624 ctx | cooccurence:619 |
Rv3233c |
Rv3233c, (MTCY20B11.08c), len: 196 aa. Possible triacylglycerol synthase (See Daniel et al., 2004), similar to C-terminus of Q9RIU8|SCM11.13 | 605 | 605 ctx | cooccurence:546 |
Rv3197 |
ABC transporter ATP-binding protein | 574 | 574 ctx | cooccurence:567 |
Rv3234c tgs3 |
diacyglycerol O-acyltransferase | 549 | 550 ctx | cooccurence:482 |
Rv0425c ctpH |
metal cation transporting ATPase H | 471 | 470 | database:451 |
Rv0107c ctpI |
cation-transporter ATPase I | 467 | 466 | database:451 |
Rv1997 ctpF |
cation transporter ATPase F | 467 | 466 | database:451 |
Rv0908 ctpE |
metal cation transporter ATPase E | 465 | 465 | database:451 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: lysophospholipid acyltransferase family protein
- Pfam (hmmscan --cut_ga): Acyltransferase PF01553.27 (E=6e-22)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215016.1)
- Domains: Pfam-A via hmmscan --cut_ga — Acyltransferase (PF01553.27)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0204 - Curated reference: UniProt P9WKT1 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
22 functional partner(s); context anchor
galE2 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000530|Rv0502| MGNVAGETRANVIPLHTNRSRVAARRRAGQRAESRQHPSLLSDPNDRASAEQIAAVVREIDEHRRAAGATTSSTEATPNDLAQLVAAVAGFLRQRLTGDYSVDEFGFDPHFNSAIVRPLLRFFFKSWFRVEVSGVENIPRDGAALVVANHAGVLPFDGLMLSVAVHDEHPAHRDLRLLAADMVFDLPVIGEAARKAGHTMACTTDAHRLLASGELTAVFPEGYKGLGKRFEDRYRLQRFGRGGFVSAALRTKAPIVPCSIIGSEEIYPMLTDVKLLARLFGLPYFPITPLFPLAGPVGLVPLPSKWRIAFGEPICTADYASTDADDPMVTFELTDQVRETIQQTLYRLLAGRRNIFFG