Rv0461 Resolved · high auto-curated

H37Rv Rv0461 · MTBC0 - · 174 aa · 552026–552550 (+) · RefSeq NP_214975.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transmembrane protein
MTBC0 PGAP re-annotation
Revised (this work)Transmembrane protein. Pfam: Rv0461 (PF27066.1).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt I6X961 SwissProt · reviewed · Evidence at protein level
UniProt nameProtein Rv0461

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2ATNP

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.071 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 1 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.46% of strains (661) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Rv0461PF27066.1 3.7e-4148–122 Rv0461-like membrane protein

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: lpdC (dihydrolipoamide dehydrogenase), high confidence from genomic context alone (score 800 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0460 hyp hypothetical protein 849 849 ctx neighborhood:826
Rv0462 lpdC dihydrolipoamide dehydrogenase 800 800 ctx neighborhood:798
Rv0463 membrane protein 800 800 ctx neighborhood:797
Rv0459 hyp hypothetical protein 750 751 ctx neighborhood:749
Rv0458 aldehyde dehydrogenase 740 740 ctx neighborhood:739
Rv0457c peptidase 681 681 ctx neighborhood:680
Rv0299 toxin 653 47 textmining:651
Rv3119 moaE1 molybdopterin synthase catalytic subunit 1 649 47 textmining:647
Rv2781c oxidoreductase 437 47 textmining:434
Rv0424c hyp hypothetical protein 870 44 textmining:870
Rv0291 mycP3 membrane-anchored mycosin MycP 413 44 textmining:412
Rv0560c benzoquinone methyltransferase 520 41 textmining:520
Rv1772 hyp hypothetical protein 511 41 textmining:511
Rv3016 lpqA lipoprotein LpqA 431 41 textmining:431
Rv2846c efpA MFS-type transporter EfpA 410 41 textmining:411

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): transmembrane protein
  • Pfam (hmmscan --cut_ga): Rv0461 PF27066.1 (E=4e-41)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214975.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Rv0461 (PF27066.1)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2ATNP
  • Curated reference: UniProt I6X961 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 15 functional partner(s); context anchor lpdC
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0461|
MPDFDTGAHSQRFLSLAGQQDRAGKSWPGSTPKPQEDPVGVAPSASVEVLGSEPAATLAHSVTVPGRYTYLKWWKFVLVVLGVWIGAGEVGLSLFYWWYHTLDKTAAVFVVLVYVVACTVGGLILALVPGRPLITALSLGVMSGPFASVAAAAPLYGYYYCERMSHCLVGVIPY