Rv0460 Family assigned · medium auto-curated
H37Rv Rv0460 · MTBC0 - ·
79 aa · 551749–551988 (+) ·
RefSeq NP_214974.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Contains Holin_9 (PF16936.11) domain(s); putative function inferred from the domain architecture. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
O53745
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | Conserved hydrophobic protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Putative holin |
| Orthologous group | 2C3BM |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Holin_9 | PF16936.11 | 7.0e-41 | 1–78 | Putative holin |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv0461 (transmembrane protein), high confidence from genomic context alone (score 849 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0461 |
transmembrane protein | 849 | 849 ctx | neighborhood:826 |
Rv0459 hyp |
hypothetical protein | 793 | 793 ctx | neighborhood:792 |
Rv0458 |
aldehyde dehydrogenase | 783 | 784 ctx | neighborhood:783 |
Rv0463 |
membrane protein | 763 | 763 ctx | neighborhood:759 |
Rv0462 lpdC |
dihydrolipoamide dehydrogenase | 762 | 762 ctx | neighborhood:759 |
Rv0457c |
peptidase | 708 | 709 ctx | neighborhood:708 |
Rv2673 aftC |
alpha-(1->3)-arabinofuranosyltransferase | 457 | 70 | textmining:441 |
Rv3805c aftB |
terminal beta-(1->2)-arabinofuranosyltransferase | 545 | 47 | textmining:543 |
Rv3505 fadE27 |
acyl-CoA dehydrogenase FadE27 | 439 | 47 | textmining:436 |
Rv3040c hyp |
hypothetical protein | 429 | 46 | textmining:427 |
Rv3692 moxR2 |
methanol dehydrogenase transcriptional regulator MoxR | 655 | 44 | textmining:654 |
Rv1459c mptB |
alpha-(1->6)-mannopyranosyltransferase | 441 | 41 | textmining:441 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
- Pfam (hmmscan --cut_ga): Holin_9 PF16936.11 (E=7e-41)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214974.1)
- Domains: Pfam-A via hmmscan --cut_ga — Holin_9 (PF16936.11)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2C3BM - Curated reference: UniProt O53745 (TrEMBL, unreviewed; Predicted)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
12 functional partner(s); context anchor
Rv0461 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv0460| MLVGNAIGLLAGVACSVLVHARIRPDIVIAMVVGIPSAIGLLVILFSGRRWVTMLGAFILALAPGWFGVLVAIQVASSG