Rv0460 Family assigned · medium auto-curated

H37Rv Rv0460 · MTBC0 - · 79 aa · 551749–551988 (+) · RefSeq NP_214974.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Contains Holin_9 (PF16936.11) domain(s); putative function inferred from the domain architecture.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt O53745 TrEMBL · unreviewed · Predicted
UniProt nameConserved hydrophobic protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionPutative holin
Orthologous group2C3BM

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Holin_9PF16936.11 7.0e-411–78 Putative holin

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0461 (transmembrane protein), high confidence from genomic context alone (score 849 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0461 transmembrane protein 849 849 ctx neighborhood:826
Rv0459 hyp hypothetical protein 793 793 ctx neighborhood:792
Rv0458 aldehyde dehydrogenase 783 784 ctx neighborhood:783
Rv0463 membrane protein 763 763 ctx neighborhood:759
Rv0462 lpdC dihydrolipoamide dehydrogenase 762 762 ctx neighborhood:759
Rv0457c peptidase 708 709 ctx neighborhood:708
Rv2673 aftC alpha-(1->3)-arabinofuranosyltransferase 457 70 textmining:441
Rv3805c aftB terminal beta-(1->2)-arabinofuranosyltransferase 545 47 textmining:543
Rv3505 fadE27 acyl-CoA dehydrogenase FadE27 439 47 textmining:436
Rv3040c hyp hypothetical protein 429 46 textmining:427
Rv3692 moxR2 methanol dehydrogenase transcriptional regulator MoxR 655 44 textmining:654
Rv1459c mptB alpha-(1->6)-mannopyranosyltransferase 441 41 textmining:441

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Pfam (hmmscan --cut_ga): Holin_9 PF16936.11 (E=7e-41)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214974.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Holin_9 (PF16936.11)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2C3BM
  • Curated reference: UniProt O53745 (TrEMBL, unreviewed; Predicted)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 12 functional partner(s); context anchor Rv0461
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0460|
MLVGNAIGLLAGVACSVLVHARIRPDIVIAMVVGIPSAIGLLVILFSGRRWVTMLGAFILALAPGWFGVLVAIQVASSG