dnaJ1 Resolved · high auto-curated
H37Rv Rv0352 · MTBC0 - ·
395 aa · 422452–423639 (+) ·
RefSeq YP_177719.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | chaperone protein DnaJ |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Chaperone protein DnaJ. Pfam: DnaJ (PF00226.37), DnaJ_C (PF01556.24), DnaJ_CXXCXGXG (PF00684.26). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
P9WNV9
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Chaperone protein DnaJ 1 |
| Curated function | Participates actively in the response to hyperosmotic and heat shock by preventing the aggregation of stress-denatured proteins and by disaggregating proteins, also in an autonomous, DnaK-independent fashion. Unfolded proteins bind initially to DnaJ; upon interaction with the DnaJ-bound protein, DnaK hydrolyzes its bound ATP, resulting in the formation of a stable complex. GrpE releases ADP from DnaK; ATP binding to DnaK triggers the release of the substrate protein, thus completing the reaction cycle. Several rounds of ATP-dependent interactions between DnaJ, DnaK and GrpE are required for fu. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
O Post-translational modification, protein turnover, chaperones
|
|---|---|
| Preferred name | dnaJ |
| eggNOG description | ATP binding to DnaK triggers the release of the substrate protein, thus completing the reaction cycle. Several rounds of ATP-dependent interactions between DnaJ, DnaK and GrpE are required for fully efficient folding. Also involved, together with DnaK and GrpE, in the DNA replication of plasmids through activation of initiation proteins |
| Orthologous group | COG0484 |
| KEGG orthology |
K03686, K05516
|
| Gene Ontology (23) |
GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0008150, GO:0010468, GO:0016020, GO:0019222, GO:0030312, GO:0040007, GO:0043388, GO:0044093 +11 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.419 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 5 synonymous, 6 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
DnaJ | PF00226.37 | 3.6e-25 | 10–72 | DnaJ domain |
DnaJ_C | PF01556.24 | 2.9e-46 | 150–362 | DnaJ C terminal domain |
DnaJ_CXXCXGXG | PF00684.26 | 1.6e-14 | 177–237 | DnaJ central domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: dnaK (chaperone protein DnaK), high confidence from genomic context alone (score 1000 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0350 dnaK |
chaperone protein DnaK | 999 | 1000 ctx | neighborhood:829 fusion:419 cooccurence:769 coexpression:942 experimental:476 database:601 textmining:948 |
Rv0351 grpE |
stress response protein GrpE | 999 | 999 ctx | neighborhood:829 coexpression:984 experimental:439 textmining:948 |
Rv0353 hspR |
heat shock protein transcriptional repressor HspR | 998 | 992 ctx | neighborhood:882 coexpression:886 experimental:469 textmining:753 |
Rv2299c htpG |
chaperone protein HtpG | 965 | 950 | coexpression:697 experimental:542 database:655 |
Rv2264c hyp |
hypothetical protein | 939 | 929 | coexpression:628 experimental:476 database:601 |
Rv0312 hyp |
hypothetical protein | 929 | 919 | coexpression:629 experimental:476 database:601 |
Rv3446c hyp |
hypothetical protein | 929 | 918 | coexpression:627 experimental:476 database:601 |
Rv0440 groEL2 |
molecular chaperone GroEL | 987 | 901 | coexpression:734 database:493 textmining:880 |
Rv3417c groEL1 |
chaperonin GroEL | 973 | 862 | coexpression:613 database:493 textmining:815 |
Rv0701 rplC |
50S ribosomal protein L3 | 859 | 853 | experimental:823 |
Rv3456c rplQ |
50S ribosomal protein L17 | 852 | 851 | experimental:825 |
Rv0714 rplN |
50S ribosomal protein L14 | 855 | 846 | experimental:819 |
Rv0723 rplO |
50S ribosomal protein L15 | 846 | 839 | experimental:821 |
Rv3443c rplM |
50S ribosomal protein L13 | 846 | 838 | experimental:822 |
Rv0640 rplK |
50S ribosomal protein L11 | 844 | 832 | experimental:818 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): chaperone protein DnaJ
- Pfam (hmmscan --cut_ga): DnaJ PF00226.37 (E=4e-25), DnaJ_C PF01556.24 (E=3e-46), DnaJ_CXXCXGXG PF00684.26 (E=2e-14)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177719.1)
- Domains: Pfam-A via hmmscan --cut_ga — DnaJ (PF00226.37), DnaJ_C (PF01556.24), DnaJ_CXXCXGXG (PF00684.26)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0484 - Curated reference: UniProt P9WNV9 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
296 functional partner(s); context anchor
dnaK - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv0352|dnaJ1 MAQREWVEKDFYQELGVSSDASPEEIKRAYRKLARDLHPDANPGNPAAGERFKAVSEAHNVLSDPAKRKEYDETRRLFAGGGFGGRRFDSGFGGGFGGFGVGGDGAEFNLNDLFDAASRTGGTTIGDLFGGLFGRGGSARPSRPRRGNDLETETELDFVEAAKGVAMPLRLTSPAPCTNCHGSGARPGTSPKVCPTCNGSGVINRNQGAFGFSEPCTDCRGSGSIIEHPCEECKGTGVTTRTRTINVRIPPGVEDGQRIRLAGQGEAGLRGAPSGDLYVTVHVRPDKIFGRDGDDLTVTVPVSFTELALGSTLSVPTLDGTVGVRVPKGTADGRILRVRGRGVPKRSGGSGDLLVTVKVAVPPNLAGAAQEALEAYAAAERSSGFNPRAGWAGNR