PPE7 Family assigned · low auto-curated

H37Rv Rv0354c · MTBC0 - · 141 aa · 424269–424694 (-) · RefSeq YP_177720.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)PPE family protein PPE7
MTBC0 PGAP re-annotation
Revised (this work)PPE family protein PPE7.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt L0T545 TrEMBL · unreviewed · Predicted
UniProt namePPE family protein PPE7

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category U Intracellular trafficking, secretion and vesicular transport
eggNOG descriptiondomain, Protein
Orthologous groupCOG3210

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.136 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 2 missense, 0 nonsense, 2 frameshift
Disruption 2 distinct premature-stop/frameshift site(s); most common in 99.20% of strains (144053) · reference-fixed

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: PPE8 (PPE family protein PPE8), medium confidence from genomic context alone (score 575 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0355c PPE8 PPE family protein PPE8 579 575 ctx neighborhood:553
Rv0357c purA adenylosuccinate synthetase 429 358
Rv2353c PPE39 PPE family protein PPE39 517 54 textmining:511
Rv0878c PPE13 PPE family protein PPE13 517 53 textmining:511
Rv2345 transmembrane protein 512 44 textmining:511
Rv3738c PPE66 PPE family protein PPE66 435 44 textmining:434
Rv3426 PPE58 PPE family protein PPE58 408 44 textmining:407
Rv2371 PE_PGRS40 PE-PGRS family protein PE_PGRS40 546 41 textmining:546
Rv0297 PE_PGRS5 PE-PGRS family protein PE_PGRS5 527 41 textmining:528
Rv3595c PE_PGRS59 PE-PGRS family protein PE_PGRS59 511 41 textmining:511
Rv2408 PE24 PE family protein PE24 434 41 textmining:434
Rv0388c PPE9 Rv0388c, (MTV036.23c), len: 180 aa. PPE9, Member of the Mycobacterium tuberculosis PPE family, highly similar to others e.g. MTCY10G2_10|Z92 432 41 textmining:432
Rv1768 PE_PGRS31 PE-PGRS family protein PE_PGRS31 431 41 textmining:431

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): PPE family protein PPE7
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177720.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3210
  • Curated reference: UniProt L0T545 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 13 functional partner(s); context anchor PPE8
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0354c|PPE7
MSVCVIYIPFKGCVKHVSVTIPITTEHLGPYEIDASTINPDQPIDTAFTQTLDFAGSGTVGAFPFGFGWQQSPGFFNSTTTPSSGFFNSGAGGASGFLNDAAAAVSGLGNVFTETSGFFNAGGVGIRASKTSATCCRAGRT