hspR Family assigned · medium auto-curated
H37Rv Rv0353 · MTBC0 mtbc0_000374 ·
126 aa · 426962–427342 (+) ·
RefSeq NP_214867.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | heat shock protein transcriptional repressor HspR |
|---|---|
| MTBC0 PGAP re-annotation | heat shock transcriptional regulator HspR |
| Revised (this work) | Heat shock transcriptional regulator HspR. Pfam: MerR_1 (PF13411.13), MerR (PF00376.30), MerR_2 (PF13591.13). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O06302
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Probable heat shock protein transcriptional repressor HspR |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
K Transcription
|
|---|---|
| Preferred name | hspR |
| eggNOG description | transcriptional |
| Orthologous group | COG0789 |
| KEGG orthology |
K13640
|
| Gene Ontology (35) |
GO:0006355, GO:0008150, GO:0009889, GO:0009890, GO:0009892, GO:0010468, GO:0010556, GO:0010558, GO:0010605, GO:0010629, GO:0019219, GO:0019222 +23 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.0 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 0 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
MerR_1 | PF13411.13 | 2.7e-17 | 15–80 | MerR HTH family regulatory protein |
MerR | PF00376.30 | 5.5e-12 | 15–50 | MerR family regulatory protein |
MerR_2 | PF13591.13 | 7.9e-07 | 21–95 | MerR HTH family regulatory protein |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: dnaJ1 (chaperone protein DnaJ), high confidence from genomic context alone (score 992 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0352 dnaJ1 |
chaperone protein DnaJ | 998 | 992 ctx | neighborhood:882 coexpression:886 experimental:469 textmining:753 |
Rv0350 dnaK |
chaperone protein DnaK | 997 | 979 ctx | neighborhood:829 coexpression:803 experimental:427 textmining:904 |
Rv0351 grpE |
stress response protein GrpE | 995 | 975 ctx | neighborhood:829 coexpression:857 textmining:829 |
Rv2373c dnaJ2 |
chaperone protein DnaJ | 797 | 619 | experimental:469 textmining:490 |
Rv2222c glnA2 |
glutamine synthetase | 633 | 614 | |
Rv2860c glnA4 |
glutamine synthetase | 594 | 573 | |
Rv0757 phoP |
two component system response transcriptional positive regulator PhoP | 651 | 565 | experimental:558 |
Rv1390 rpoZ |
DNA-directed RNA polymerase subunit omega | 574 | 558 | experimental:463 |
Rv2220 glnA1 |
glutamine synthetase | 540 | 516 | |
Rv1878 glnA3 |
glutamine synthetase GlnA | 535 | 512 | |
Rv2710 sigB |
RNA polymerase sigma factor SigB | 710 | 486 | experimental:436 textmining:459 |
Rv3457c rpoA |
DNA-directed RNA polymerase subunit alpha | 509 | 485 | experimental:463 |
Rv2703 sigA |
RNA polymerase sigma factor SigA | 709 | 484 | experimental:436 textmining:460 |
Rv0667 rpoB |
DNA-directed RNA polymerase subunit beta | 511 | 480 | experimental:475 |
Rv0668 rpoC |
DNA-directed RNA polymerase subunit beta' | 486 | 466 | experimental:463 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: heat shock protein transcriptional repressor HspR
- MTBC0 PGAP product: heat shock transcriptional regulator HspR
- Pfam (hmmscan --cut_ga): MerR_1 PF13411.13 (E=3e-17), MerR PF00376.30 (E=6e-12), MerR_2 PF13591.13 (E=8e-07)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214867.1)
- Domains: Pfam-A via hmmscan --cut_ga — MerR_1 (PF13411.13), MerR (PF00376.30), MerR_2 (PF13591.13)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0789 - Curated reference: UniProt O06302 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
32 functional partner(s); context anchor
dnaJ1 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000374|Rv0353|hspR MAKNPKDGESRTFLISVAAELAGMHAQTLRTYDRLGLVSPRRTSGGGRRYSLHDVELLRQVQHLSQDEGVNLAGIKRIIELTSQVEALQSRLQEMAEELAVLRANQRREVAVVPKSTALVVWKPRR