hspR Family assigned · medium auto-curated

H37Rv Rv0353 · MTBC0 mtbc0_000374 · 126 aa · 426962–427342 (+) · RefSeq NP_214867.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)heat shock protein transcriptional repressor HspR
MTBC0 PGAP re-annotationheat shock transcriptional regulator HspR
Revised (this work)Heat shock transcriptional regulator HspR. Pfam: MerR_1 (PF13411.13), MerR (PF00376.30), MerR_2 (PF13591.13).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O06302 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable heat shock protein transcriptional repressor HspR

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
Preferred namehspR
eggNOG descriptiontranscriptional
Orthologous groupCOG0789
KEGG orthology K13640
Gene Ontology (35) GO:0006355, GO:0008150, GO:0009889, GO:0009890, GO:0009892, GO:0010468, GO:0010556, GO:0010558, GO:0010605, GO:0010629, GO:0019219, GO:0019222 +23 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
MerR_1PF13411.13 2.7e-1715–80 MerR HTH family regulatory protein
MerRPF00376.30 5.5e-1215–50 MerR family regulatory protein
MerR_2PF13591.13 7.9e-0721–95 MerR HTH family regulatory protein

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: dnaJ1 (chaperone protein DnaJ), high confidence from genomic context alone (score 992 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0352 dnaJ1 chaperone protein DnaJ 998 992 ctx neighborhood:882 coexpression:886 experimental:469 textmining:753
Rv0350 dnaK chaperone protein DnaK 997 979 ctx neighborhood:829 coexpression:803 experimental:427 textmining:904
Rv0351 grpE stress response protein GrpE 995 975 ctx neighborhood:829 coexpression:857 textmining:829
Rv2373c dnaJ2 chaperone protein DnaJ 797 619 experimental:469 textmining:490
Rv2222c glnA2 glutamine synthetase 633 614
Rv2860c glnA4 glutamine synthetase 594 573
Rv0757 phoP two component system response transcriptional positive regulator PhoP 651 565 experimental:558
Rv1390 rpoZ DNA-directed RNA polymerase subunit omega 574 558 experimental:463
Rv2220 glnA1 glutamine synthetase 540 516
Rv1878 glnA3 glutamine synthetase GlnA 535 512
Rv2710 sigB RNA polymerase sigma factor SigB 710 486 experimental:436 textmining:459
Rv3457c rpoA DNA-directed RNA polymerase subunit alpha 509 485 experimental:463
Rv2703 sigA RNA polymerase sigma factor SigA 709 484 experimental:436 textmining:460
Rv0667 rpoB DNA-directed RNA polymerase subunit beta 511 480 experimental:475
Rv0668 rpoC DNA-directed RNA polymerase subunit beta' 486 466 experimental:463

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: heat shock protein transcriptional repressor HspR
  • MTBC0 PGAP product: heat shock transcriptional regulator HspR
  • Pfam (hmmscan --cut_ga): MerR_1 PF13411.13 (E=3e-17), MerR PF00376.30 (E=6e-12), MerR_2 PF13591.13 (E=8e-07)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214867.1)
  • Domains: Pfam-A via hmmscan --cut_ga — MerR_1 (PF13411.13), MerR (PF00376.30), MerR_2 (PF13591.13)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0789
  • Curated reference: UniProt O06302 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 32 functional partner(s); context anchor dnaJ1
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000374|Rv0353|hspR
MAKNPKDGESRTFLISVAAELAGMHAQTLRTYDRLGLVSPRRTSGGGRRYSLHDVELLRQVQHLSQDEGVNLAGIKRIIELTSQVEALQSRLQEMAEELAVLRANQRREVAVVPKSTALVVWKPRR