Rv0228 Resolved · high auto-curated

H37Rv Rv0228 · MTBC0 mtbc0_000242 · 407 aa · 273436–274659 (+) · RefSeq NP_214742.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)acyltransferase
MTBC0 PGAP re-annotationacyltransferase
Revised (this work)Acyltransferase. Pfam: Acyl_transf_3 (PF01757.29).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P96410 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable integral membrane acyltransferase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
eggNOG descriptionAcyltransferase
Orthologous groupCOG1835

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.771 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Acyl_transf_3PF01757.29 6.4e-2938–370 Acyltransferase domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0226c (transmembrane protein), high confidence from genomic context alone (score 773 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0226c transmembrane protein 831 773 ctx neighborhood:582 cooccurence:466
Rv0227c membrane protein 748 744 ctx neighborhood:582 cooccurence:409
Rv3802c membrane protein 608 588 ctx cooccurence:571
Rv0224c methyltransferase 571 571 ctx cooccurence:567
Rv3803c fbpD MPT51/MPB51 antigen 568 568 ctx cooccurence:565
Rv0111 acyltransferase 540 541 ctx cooccurence:535
Rv2673 aftC alpha-(1->3)-arabinofuranosyltransferase 521 521 ctx cooccurence:514
Rv0225 hyp hypothetical protein 531 507 ctx cooccurence:476
Rv0129c fbpC diacylglycerol acyltransferase/mycolyltransferase Ag85C 478 473 ctx cooccurence:470
Rv1476 membrane protein 471 472 ctx cooccurence:471
Rv1489A hyp hypothetical protein 462 463 ctx cooccurence:462
Rv3035 hyp hypothetical protein 448 449 ctx cooccurence:440
Rv1354c hyp hypothetical protein 449 448 coexpression:416
Rv2721c hyp hypothetical protein 446 447 ctx cooccurence:432
Rv3635 transmembrane protein 457 433

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: acyltransferase
  • MTBC0 PGAP product: acyltransferase
  • Pfam (hmmscan --cut_ga): Acyl_transf_3 PF01757.29 (E=6e-29)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214742.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Acyl_transf_3 (PF01757.29)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1835
  • Curated reference: UniProt P96410 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 33 functional partner(s); context anchor Rv0226c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000242|Rv0228|
MGPADESGAPIRPQTPHRHTVLVTNGQVVGGTRGFLPAVEGMRACAAVGVVVTHVAFQTGHSSGVGGRLFGRFDLAVAVFFAVSGFLLWRGHAAAARDLRSHPRTGPYLRSRVARIMPAYVVAVVVILSLLPDADHASLTVWLANLTLTQIYVPLTLTGGLTQMWSLSVEVAFYAALPVLALLGRRIPVGARVPAIAALAALSWAWGWLPLDAGSGINPLTWPPAFFSWFAAGMLLAEWAYSPVGLPHRWARRRVAMAVTALLGYLVAASPLAGPEGLVPGTAAQFAVKTAMGSLVAFALVAPLVLDRPDTSHRLLGSPAMVTLGRWSYGLFIWHLAALAMVFPVIGAFPFTGRMPTVLVLTLIFGFAIAAVSYALVESPCREALRRWERRNEPISVGELQADAIAP