Rv0225 Family assigned · medium
H37Rv Rv0225 · MTBC0 mtbc0_000239 ·
384 aa ·
269044–270198 MTBC0
(+) ·
RefSeq NP_214739.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | glycosyltransferase family 4 protein |
| Revised (this work) | Glycosyltransferase family 4 (GT-B fold) protein (Pfam Glycos_transf_1 PF00534 with GT4 domains). Transfers a sugar moiety to an acceptor; the specific donor/acceptor is not established. |
| Functional category (TubercuList) | cell wall and cell processes |
In the literature (TB corpus sweep) 2 publications
Found under: H37Rv (1), M. smegmatis (1).
2 TB publications mention this gene. 2 publication(s) mention this gene (title/abstract), verified against the text. The atlas states the function; these are the primary sources that discuss it.
| Publication | Date |
|---|---|
| A putative mycobacterial GDP-mannose dependent α-mannosyltransferase Rv0225 acts as PimC: an in-silico study. doi:10.1080/07391102.2024.2437686 | 2026 |
| MSMEG_0311 is a conserved essential polar protein involved in mycobacterium cell wall metabolism. doi:10.1016/j.ijbiomac.2024.129583 | 2024 |
This layer CITES the literature, it does not change the verdict or the function. A gene may be heavily studied (as an antigen, a resistance determinant, a drug target) while its molecular function is settled elsewhere in the fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole), MULTI-ALIAS sweep: H37Rv locus tag AND every ortholog identifier (M. bovis Mb…, M. marinum MMAR_…, M. smegmatis MSMEG_…, M. leprae ML…, M. abscessus MAB_…), each hit VERIFIED against the abstract text (word-boundary regex). phase73/phase75, 2026-07-13.
CRISPRi vulnerability
Vulnerability index -8.76 (95% CI -10.05 to -7.38). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Possibly involved in LPS biosynthesis. |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb0230
· 100.0% identity |
|---|---|
| M. leprae |
ML2583c
· 84.9% identity |
| M. marinum |
MMAR_0474
· 83.5% identity |
| M. smegmatis |
MSMEG_0311
· 75.6% identity |
| M. orygis |
RJtmp_000239
· 100.0% identity |
| M. abscessus |
MAB_4480c
· 62.2% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P96407
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Possible conserved protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
M Cell wall / membrane / envelope biogenesis
|
|---|---|
| eggNOG description | glycosyl transferase |
| Orthologous group | COG0438 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.0 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 0 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 82.5%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 8/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 55.4% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis) essential
| DeJesus 2017 call | ES · essential |
|---|---|
| What the call means | essential: insertions absent across the whole ORF |
| TA sites (Himar1) | 20 in the ORF — 20 in the essential state, 0 growth-defect, 0 non-essential, 0 growth-advantage. Saturation 0.000, mean read count 0. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Chemical-genetic target & druggability (PROSPECT) hypomorph tool strain
This gene is part of the PROSPECT collection of TetON transcriptional-knockdown (hypomorph) strains of essential M. tuberculosis genes, built as a sensitised background for chemical-genetic mechanism-of-action deconvolution. Being in the panel means the gene is an essential / vulnerable target for which a validated knockdown tool strain exists.
| Hypomorph strain | Rv0225-Rv0225_teton2.1 (TetON promoter 2) |
|---|---|
| Baseline knockdown fitness | 5.011 median doublings (across 6 screen pool(s)) — fewer doublings = stronger growth defect on knockdown |
| Used in target deconvolution | yes (informs phenotypic-cluster / MOA assignment) |
Panel membership reflects essentiality/vulnerability and the availability of a genetic tool, not a specific molecular function; it never changes the verdict here. Source: Bond AN et al., Nat Commun 2025;16:9673 (doi:10.1038/s41467-025-64662-x); PROSPECT chemical-genetic platform.
Proteomics (mass spectrometry) detected
| MS detection | detected in 6 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 0.24 ppm · rank 3420/3519 (2.8th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 384 aa |
|---|---|
| Molecular weight | 42.1 kDa |
| Theoretical pI | 9.86 |
| GRAVY | -0.012 (hydrophilic) |
| Aliphatic index | 105.6 |
| Aromaticity | 0.06 |
| Instability index | 46.0 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Glyco_transf_4 | PF13439.13 | 6.1e-17 | 21–186 | Glycosyltransferase Family 4 |
Glyco_trans_4_4 | PF13579.13 | 5.7e-14 | 21–183 | Glycosyl transferase 4-like domain |
GT4-conflict | PF20706.4 | 1.1e-10 | 175–317 | Family 4 Glycosyltransferase in conflict systems |
Glycos_transf_1 | PF00534.27 | 5.7e-31 | 200–353 | Glycosyl transferases group 1 |
Glyco_trans_1_4 | PF13692.13 | 1.6e-23 | 200–340 | Glycosyl transferases group 1 |
Glyco_trans_1_2 | PF13524.13 | 1.2e-07 | 221–367 | Glycosyl transferase-like |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 95.0
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
6kih-assembly4_D |
1.00 | 0.80 | 2.6e-18 sig | 6kih-assembly4_D Sucrose-phosphate synthase (tll1590) from Thermosynechococcus elongatus |
3c48-assembly1_A |
1.00 | 0.47 | 3.4e-20 sig | 3c48-assembly1_A Structure of the retaining glycosyltransferase MshA: The first step in mycothiol biosynthesis. Organism: Corynebacterium glutamicum- APO (OPEN) structure. |
7qsg-assembly2_B |
1.00 | 0.80 | 5.0e-15 sig | 7qsg-assembly2_B Methylmannose polysaccharide mannosyltransferase from M. hassiacum |
3c48-assembly1_B |
1.00 | 0.46 | 5.1e-20 sig | 3c48-assembly1_B Structure of the retaining glycosyltransferase MshA: The first step in mycothiol biosynthesis. Organism: Corynebacterium glutamicum- APO (OPEN) structure. |
2bis-assembly1_A |
1.00 | 0.69 | 1.6e-16 sig | 2bis-assembly1_A Structure of glycogen synthase from Pyrococcus abyssi |
Foldseek search of the AlphaFold DB model (mean pLDDT 95.0, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | Rv0224c (- strand, 35 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv0226c (- strand, 16 bp gap) |
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (2 TF) |
csoR (represses) · Rv1990c (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: Rv0224c (methyltransferase), high confidence from genomic context alone (score 898 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0224c |
methyltransferase | 898 | 898 ctx | neighborhood:615 cooccurence:745 |
Rv1562c treZ exp |
malto-oligosyltrehalose trehalohydrolase | 801 | 782 | coexpression:411 database:572 |
Rv1326c glgB exp |
1,4-alpha-glucan branching protein | 815 | 781 | coexpression:409 database:572 |
Rv0223c |
aldehyde dehydrogenase | 730 | 720 ctx | neighborhood:705 |
Rv0226c |
transmembrane protein | 719 | 705 ctx | cooccurence:692 |
Rv2529 hyp exp |
hypothetical protein | 673 | 661 | database:516 |
Rv0236c aftD |
alpha-(1->3)-arabinofuranosyltransferase | 667 | 649 ctx | cooccurence:627 |
Rv0227c |
membrane protein | 644 | 644 ctx | cooccurence:634 |
Rv2673 aftC |
alpha-(1->3)-arabinofuranosyltransferase | 609 | 607 ctx | cooccurence:601 |
Rv3784 |
dTDP-glucose 4,6-dehydratase | 591 | 570 | coexpression:414 |
Rv3802c |
membrane protein | 583 | 560 ctx | cooccurence:556 |
Rv0228 |
acyltransferase | 531 | 507 ctx | cooccurence:476 |
Rv3464 rmlB |
dTDP-glucose 4,6-dehydratase | 529 | 505 | coexpression:418 |
Rv1328 glgP |
glycogen phosphorylase | 534 | 492 | coexpression:404 |
Rv3809c glf |
UDP-galactopyranose mutase | 515 | 490 | coexpression:473 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- MTBC0 PGAP product: 'glycosyltransferase family 4 protein'
- Pfam: Glycos_transf_1 PF00534 (E=5.7e-31), Glyco_transf_4 PF13439, GT4 domains
ESM Atlas signal (exploratory)
Ancestral protein hash 8de903672994e04ce6368c5cafc19adc ·
10 ESM-space neighbours (max similarity 0.942).
SAE features are orienting indices, not validated domains.
| # | Index | Activation | Interpretation |
|---|---|---|---|
| 1 | 15113 |
1.36 | Glycosyltransferase aromatic stacking clamp |
| 2 | 14002 |
1.29 | Carbohydrate recognition surface elements |
| 3 | 12287 |
1.23 | Glycosyltransferase donor-binding acidic loop |
| 4 | 10225 |
1.21 | Glycosyltransferase acidic donor motif |
| 5 | 13813 |
1.18 | Membrane-proximal GT acceptor hairpin |
| 6 | 5820 |
1.14 | Conserved hydrophobic beta-strand scaffold |
| 7 | 11299 |
1.14 | Glycosyltransferase donor binding core |
| 8 | 6700 |
1.11 | Expand nucleotide sugar donors |
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214739.1)
- Domains: Pfam-A via hmmscan --cut_ga — Glyco_transf_4 (PF13439.13), Glyco_trans_4_4 (PF13579.13), GT4-conflict (PF20706.4), Glycos_transf_1 (PF00534.27), Glyco_trans_1_4 (PF13692.13), Glyco_trans_1_2 (PF13524.13)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0438 - Curated reference: UniProt P96407 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 95.0)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
36 functional partner(s); context anchor
Rv0224c - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000239|Rv0225| MSALRSVLLLCWRDIGHPQGGGSEAYLQRIGAQLAASGIAVTLRTARYPGAPRHELVDGVRISRAGGRYSVYLWALLAMAAARCGLGPLRRVRPDVVVDTQNGWPFVARLLYGRRSLVLVHHCHREQWPVAGRMMGRLGWYVESMLSPRLHRRNQYVTVSLPSARDLIALGVDSERIAVVRNGLDEAPSPTLSGPRAPTPRVVVLSRLVPHKQIEDALAAVAELQPRIPGLHLDIVGGGWWRQRLVDHVHRLDIADAVTFHGHVDDVTKHHVLQSSWVHLLPSRKEGWGLAVIEAAQHGVPTIGYRSSGGLADSIVDGVTGILVDDRAELVAWLEQLLSDSVLRDQLGAKAQARSGEFSWRQSAEALRSVLEAVQASRFVSGVV
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for Rv0225? Email the maintainer — the message is pre-filled with this gene's details.