Rv3814c Resolved · high auto-curated
H37Rv Rv3814c · MTBC0 mtbc0_004043 ·
261 aa · 4303340–4304125 (-) ·
RefSeq NP_218331.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | acyltransferase |
|---|---|
| MTBC0 PGAP re-annotation | 1-acyl-sn-glycerol-3-phosphate acyltransferase |
| Revised (this work) | 1-acyl-sn-glycerol-3-phosphate acyltransferase. Pfam: Acyltransferase (PF01553.27). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O07809
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Possible acyltransferase |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
I Lipid transport and metabolism
|
|---|---|
| Preferred name | plsC1 |
| eggNOG description | Acyltransferase |
| Orthologous group | COG0204 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.657 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 4 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Acyltransferase | PF01553.27 | 2.3e-35 | 23–150 | Acyltransferase |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv3816c (acyltransferase), high confidence from genomic context alone (score 816 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3816c |
acyltransferase | 816 | 816 ctx | neighborhood:803 |
Rv3815c |
acyltransferase | 807 | 807 ctx | neighborhood:803 |
Rv3813c hyp |
hypothetical protein | 776 | 776 ctx | neighborhood:776 |
Rv3817 |
phosphotransferase | 581 | 581 ctx | neighborhood:581 |
Rv3818 hyp |
hypothetical protein | 504 | 495 ctx | neighborhood:495 |
Rv3819 hyp |
hypothetical protein | 495 | 495 ctx | neighborhood:495 |
Rv0425c ctpH |
metal cation transporting ATPase H | 464 | 463 | database:451 |
Rv0107c ctpI |
cation-transporter ATPase I | 464 | 463 | database:451 |
Rv1997 ctpF |
cation transporter ATPase F | 464 | 463 | database:451 |
Rv0908 ctpE |
metal cation transporter ATPase E | 464 | 463 | database:451 |
Rv1305 atpE |
ATP synthase subunit C | 447 | 448 | database:434 |
Rv2139 pyrD |
dihydroorotate dehydrogenase | 420 | 421 | coexpression:412 |
Rv2524c fas |
fatty acid synthase | 476 | 314 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: acyltransferase
- MTBC0 PGAP product: 1-acyl-sn-glycerol-3-phosphate acyltransferase
- Pfam (hmmscan --cut_ga): Acyltransferase PF01553.27 (E=2e-35)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218331.1)
- Domains: Pfam-A via hmmscan --cut_ga — Acyltransferase (PF01553.27)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0204 - Curated reference: UniProt O07809 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
13 functional partner(s); context anchor
Rv3816c - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_004043|Rv3814c| MAEPFFRMMEILVPSIVAANGNKITFEGLENIPERGGALIALNHTSYVDWVPASIAAHHRRRRLRFMIKAEMQDVRAVNYVIKHAQLIPVDRSVGADAYAVAVQRLRAGELVGLHPEATISRSLELREFKTGAARMALEAQVPIIPMIVWGAHRIWPKDHPKNLFRNKIPIVAAIGSPVRPEGNAEQLNAVLRQAMNAILYRVQEEYPHPKGEHWVPRRLGGGAPTVEESRQLRIAELAKRRQKRGYDGVTSSRRSQVGPH