Rv3814c Resolved · high auto-curated

H37Rv Rv3814c · MTBC0 mtbc0_004043 · 261 aa · 4303340–4304125 (-) · RefSeq NP_218331.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)acyltransferase
MTBC0 PGAP re-annotation1-acyl-sn-glycerol-3-phosphate acyltransferase
Revised (this work)1-acyl-sn-glycerol-3-phosphate acyltransferase. Pfam: Acyltransferase (PF01553.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O07809 TrEMBL · unreviewed · Evidence at protein level
UniProt namePossible acyltransferase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
Preferred nameplsC1
eggNOG descriptionAcyltransferase
Orthologous groupCOG0204

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.657 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
AcyltransferasePF01553.27 2.3e-3523–150 Acyltransferase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3816c (acyltransferase), high confidence from genomic context alone (score 816 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3816c acyltransferase 816 816 ctx neighborhood:803
Rv3815c acyltransferase 807 807 ctx neighborhood:803
Rv3813c hyp hypothetical protein 776 776 ctx neighborhood:776
Rv3817 phosphotransferase 581 581 ctx neighborhood:581
Rv3818 hyp hypothetical protein 504 495 ctx neighborhood:495
Rv3819 hyp hypothetical protein 495 495 ctx neighborhood:495
Rv0425c ctpH metal cation transporting ATPase H 464 463 database:451
Rv0107c ctpI cation-transporter ATPase I 464 463 database:451
Rv1997 ctpF cation transporter ATPase F 464 463 database:451
Rv0908 ctpE metal cation transporter ATPase E 464 463 database:451
Rv1305 atpE ATP synthase subunit C 447 448 database:434
Rv2139 pyrD dihydroorotate dehydrogenase 420 421 coexpression:412
Rv2524c fas fatty acid synthase 476 314

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: acyltransferase
  • MTBC0 PGAP product: 1-acyl-sn-glycerol-3-phosphate acyltransferase
  • Pfam (hmmscan --cut_ga): Acyltransferase PF01553.27 (E=2e-35)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218331.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Acyltransferase (PF01553.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0204
  • Curated reference: UniProt O07809 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 13 functional partner(s); context anchor Rv3816c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_004043|Rv3814c|
MAEPFFRMMEILVPSIVAANGNKITFEGLENIPERGGALIALNHTSYVDWVPASIAAHHRRRRLRFMIKAEMQDVRAVNYVIKHAQLIPVDRSVGADAYAVAVQRLRAGELVGLHPEATISRSLELREFKTGAARMALEAQVPIIPMIVWGAHRIWPKDHPKNLFRNKIPIVAAIGSPVRPEGNAEQLNAVLRQAMNAILYRVQEEYPHPKGEHWVPRRLGGGAPTVEESRQLRIAELAKRRQKRGYDGVTSSRRSQVGPH