Rv3813c Family assigned · medium auto-curated

H37Rv Rv3813c · MTBC0 mtbc0_004042 · 273 aa · 4302504–4303325 (-) · RefSeq NP_218330.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationCof-type HAD-IIB family hydrolase
Revised (this work)Cof-type HAD-IIB family hydrolase. Pfam: Hydrolase_3 (PF08282.19), S6PP (PF05116.20).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O07810 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionhydrolase
Orthologous groupCOG0561

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.268 · purifying
Polymorphic sites (≥ 0.1% of strains) 8 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Hydrolase_3PF08282.19 1.9e-589–268 haloacid dehalogenase-like hydrolase
S6PPPF05116.20 5.2e-06170–257 Sucrose-6F-phosphate phosphohydrolase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3816c (acyltransferase), high confidence from genomic context alone (score 852 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3816c acyltransferase 851 852 ctx neighborhood:852
Rv3814c acyltransferase 776 776 ctx neighborhood:776
Rv3815c acyltransferase 771 771 ctx neighborhood:742
Rv3818 hyp hypothetical protein 581 566 ctx neighborhood:565
Rv3817 phosphotransferase 563 563 ctx neighborhood:558
Rv2006 otsB1 trehalose-6-phosphate phosphatase OtsB 532 456 ctx neighborhood:438
Rv3013 hyp hypothetical protein 465 446
Rv3819 hyp hypothetical protein 428 429 ctx neighborhood:425
Rv3264c manB D-alpha-D-mannose-1-phosphate guanylyltransferase ManB 522 390
Rv2584c apt adenine phosphoribosyltransferase 417 383
Rv0946c pgi glucose-6-phosphate isomerase 427 335
Rv3255c manA mannose-6-phosphate isomerase 405 223
Rv2870c dxr 1-deoxy-D-xylulose 5-phosphate reductoisomerase 491 65 textmining:478

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: Cof-type HAD-IIB family hydrolase
  • Pfam (hmmscan --cut_ga): Hydrolase_3 PF08282.19 (E=2e-58), S6PP PF05116.20 (E=5e-06)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218330.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Hydrolase_3 (PF08282.19), S6PP (PF05116.20)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0561
  • Curated reference: UniProt O07810 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 13 functional partner(s); context anchor Rv3816c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_004042|Rv3813c|
MKPTVPALVACDVDGTLLDDGETVTKRTRDAVHAAVDAGTHFILATGRPPRWVRPIVDALGFAPMAVCANGAVIYDPGTDRVMSVRTLPVDALATLAEVATRVIPGAGLAVERIGERAHDTATPQFVSSPGYEHAWLNPDNTEVSIDHLLSAPAIKLLIRKAGAASADMAAELAKHVGFEGDITYSTNNGLVEIVPLGISKATGVDEIARPLGISDAEVVAFGDMPNDVPMLLRAGLGVAMGNAHPDALAVADEVTAPNSEDGVARVLERWWS