PE25 Family assigned · medium auto-curated

H37Rv Rv2431c · MTBC0 - · 99 aa · 2727967–2728266 (-) · RefSeq YP_177882.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)PE family protein PE25
MTBC0 PGAP re-annotation
Revised (this work)PE family protein PE25. Pfam: PE (PF00934.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt I6X486 SwissProt · reviewed · Evidence at protein level
UniProt namePE-PGRS family protein PE25
Curated functionThe PE25/PPE41 dimer induces both a strong humoral and cellular immune response. PE25 protein alone induces low response. The dimer induces necrosis, but not apoptosis, in mouse macrophage cells. It also induces activation and maturation of mouse dendritic cells and drives Th2-biased immune responses.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category N Cell motility
eggNOG descriptionPFAM PE-PPE, C-terminal
Orthologous groupCOG0657

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PEPF00934.26 1.3e-214–94 PE family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: PPE41 (PPE family protein PPE41), high confidence from genomic context alone (score 964 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2430c PPE41 PPE family protein PPE41 999 964 ctx neighborhood:675 experimental:893 textmining:996
Rv1794 espG5 hyp hypothetical protein 967 898 experimental:898 textmining:692
Rv2434c transmembrane protein 492 492 ctx neighborhood:492
Rv2432c hyp hypothetical protein 492 492 ctx neighborhood:492
Rv2433c nrtS hyp hypothetical protein 492 492 ctx neighborhood:492
Rv2435c cyclase 479 479 ctx neighborhood:479
Rv2608 PPE42 PPE family protein PPE42 671 155 textmining:628
Rv1787 PPE25 PPE family protein PPE25 659 155 textmining:613
Rv3539 PPE63 PPE family protein PPE63 623 155 textmining:573
Rv0152c PE2 PE family protein PE2 621 155 textmining:570
Rv1168c PPE17 PPE family protein PPE17 604 155 textmining:551
Rv2108 PPE36 PPE family protein PPE36 542 155 textmining:481
Rv0286 PPE4 PPE family protein PPE4 536 155 textmining:474
Rv1800 PPE28 PPE family protein PPE28 517 155 textmining:453
Rv3739c PPE67 PPE family protein PPE67 478 155 textmining:408

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): PE family protein PE25
  • Pfam (hmmscan --cut_ga): PE PF00934.26 (E=1e-21)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177882.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PE (PF00934.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0657
  • Curated reference: UniProt I6X486 (SwissProt, reviewed; Evidence at protein level)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 30 functional partner(s); context anchor PPE41
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2431c|PE25
MSFVITNPEALTVAATEVRRIRDRAIQSDAQVAPMTTAVRPPAADLVSEKAATFLVEYARKYRQTIAAAAVVLEEFAHALTTGADKYATAEADNIKTFS