PE25 Family assigned · medium auto-curated
H37Rv Rv2431c · MTBC0 - ·
99 aa · 2727967–2728266 (-) ·
RefSeq YP_177882.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | PE family protein PE25 |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | PE family protein PE25. Pfam: PE (PF00934.26). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
I6X486
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | PE-PGRS family protein PE25 |
| Curated function | The PE25/PPE41 dimer induces both a strong humoral and cellular immune response. PE25 protein alone induces low response. The dimer induces necrosis, but not apoptosis, in mouse macrophage cells. It also induces activation and maturation of mouse dendritic cells and drives Th2-biased immune responses. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
N Cell motility
|
|---|---|
| eggNOG description | PFAM PE-PPE, C-terminal |
| Orthologous group | COG0657 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
PE | PF00934.26 | 1.3e-21 | 4–94 | PE family |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: PPE41 (PPE family protein PPE41), high confidence from genomic context alone (score 964 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2430c PPE41 |
PPE family protein PPE41 | 999 | 964 ctx | neighborhood:675 experimental:893 textmining:996 |
Rv1794 espG5 hyp |
hypothetical protein | 967 | 898 | experimental:898 textmining:692 |
Rv2434c |
transmembrane protein | 492 | 492 ctx | neighborhood:492 |
Rv2432c hyp |
hypothetical protein | 492 | 492 ctx | neighborhood:492 |
Rv2433c nrtS hyp |
hypothetical protein | 492 | 492 ctx | neighborhood:492 |
Rv2435c |
cyclase | 479 | 479 ctx | neighborhood:479 |
Rv2608 PPE42 |
PPE family protein PPE42 | 671 | 155 | textmining:628 |
Rv1787 PPE25 |
PPE family protein PPE25 | 659 | 155 | textmining:613 |
Rv3539 PPE63 |
PPE family protein PPE63 | 623 | 155 | textmining:573 |
Rv0152c PE2 |
PE family protein PE2 | 621 | 155 | textmining:570 |
Rv1168c PPE17 |
PPE family protein PPE17 | 604 | 155 | textmining:551 |
Rv2108 PPE36 |
PPE family protein PPE36 | 542 | 155 | textmining:481 |
Rv0286 PPE4 |
PPE family protein PPE4 | 536 | 155 | textmining:474 |
Rv1800 PPE28 |
PPE family protein PPE28 | 517 | 155 | textmining:453 |
Rv3739c PPE67 |
PPE family protein PPE67 | 478 | 155 | textmining:408 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): PE family protein PE25
- Pfam (hmmscan --cut_ga): PE PF00934.26 (E=1e-21)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177882.1)
- Domains: Pfam-A via hmmscan --cut_ga — PE (PF00934.26)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0657 - Curated reference: UniProt I6X486 (SwissProt, reviewed; Evidence at protein level)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
30 functional partner(s); context anchor
PPE41 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv2431c|PE25 MSFVITNPEALTVAATEVRRIRDRAIQSDAQVAPMTTAVRPPAADLVSEKAATFLVEYARKYRQTIAAAAVVLEEFAHALTTGADKYATAEADNIKTFS