lucA Resolved · high auto-curated

H37Rv Rv3723 · MTBC0 mtbc0_003948 · 254 aa · 4192657–4193421 (+) · RefSeq NP_218240.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transmembrane protein
MTBC0 PGAP re-annotationlipid uptake coordinator LucA
Revised (this work)Lipid uptake coordinator LucA. Pfam: LUCA (PF26307.1).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O69690 SwissProt · reviewed · Evidence at protein level
UniProt nameLipid uptake coordinator A
Curated functionRequired for the import of both fatty acids and cholesterol during growth in macrophages and in axenic culture. Facilitates the uptake of these lipids by stabilizing protein subunits of the Mce1 and Mce4 multi-subunit transporters, which transport fatty acids and cholesterol, respectively. Required for full virulence in vivo.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2AKY4
Gene Ontology (12) GO:0005575, GO:0005623, GO:0005886, GO:0005887, GO:0016020, GO:0016021, GO:0031224, GO:0031226, GO:0044425, GO:0044459, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.716 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
LUCAPF26307.1 1.3e-683–137 Lipid uptake coordinator A family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: cut5b (Rv3724B, (MTV025.072), len: 187 aa. Probable cut5b,truncated cutinase, similar to C-terminal end of others e.g. Q9XB09|RVD2-RV1758 protein (), medium confidence from genomic context alone (score 468 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3722c hyp hypothetical protein 510 510 ctx neighborhood:507
Rv3724B cut5b Rv3724B, (MTV025.072), len: 187 aa. Probable cut5b,truncated cutinase, similar to C-terminal end of others e.g. Q9XB09|RVD2-RV1758 protein ( 468 468 ctx neighborhood:463
Rv3724A cut5a Rv3724A, (MTV025.072), len: 80 aa. Probable cut5a,truncated cutinase precursor, similar to N-terminal end of others e.g. Q9KK87 serine ester 468 468 ctx neighborhood:463
Rv2219 transmembrane protein 442 55 textmining:434
Rv0547c oxidoreductase 861 50 textmining:860
Rv1013 pks16 polyketide synthase 439 50 textmining:434
Rv3499c mce4A Mce family protein Mce4A 650 47 textmining:648
Rv1226c transmembrane protein 436 47 textmining:433
Rv0587 yrbE2A hyp hypothetical protein 808 44 textmining:808
Rv3445c esxU ESAT-6 like protein EsxU 441 44 textmining:440
Rv3234c tgs3 diacyglycerol O-acyltransferase 435 44 textmining:434
Rv1964 yrbE3A integral membrane protein 403 44 textmining:402
Rv3484 cpsA hyp hypothetical protein 436 42 textmining:436
Rv2308 hyp hypothetical protein 860 41 textmining:860
Rv1414 hyp hypothetical protein 860 41 textmining:860

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: transmembrane protein
  • MTBC0 PGAP product: lipid uptake coordinator LucA
  • Pfam (hmmscan --cut_ga): LUCA PF26307.1 (E=1e-68)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218240.1)
  • Domains: Pfam-A via hmmscan --cut_ga — LUCA (PF26307.1)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2AKY4
  • Curated reference: UniProt O69690 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 17 functional partner(s); context anchor cut5b
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003948|Rv3723|lucA
MGRKVAVLWHASFSIGAGVLYFYFVLPRWPELMGDTGHSLGTGLRIATGALVGLAALPVVFTLLRTRKPELGTPQLALSMRIWSIMAHVLAGALIVGTAISEVWLSLDAAGQWLFGIYGAAAAIAVLGFFGFYLSFVAELPPPPPKPLKPKKPKQRRLRRKKTAKGDEAEPEAAEEAENTELAAQEDEEAVEAPPESIESPGGEPESATREAPAAETATAEEPRGGLRNRRPTGKTSHRRRRTRSGVQVAKVDE