PE_PGRS61 Family assigned · medium auto-curated
H37Rv Rv3653 · MTBC0 - ·
195 aa · 4093940–4094527 (+) ·
RefSeq YP_178002.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | PE-PGRS family-related protein PE_PGRS61 |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | PE-PGRS family-related protein PE_PGRS61. Pfam: PGRS (PF21526.3). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
Q6MWV0
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | PE-PGRS family protein PE_PGRS61 |
| Curated function | Mediates Ca(2+)-dependent up-regulation of the anti-inflammatory cytokine IL-10. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
I Lipid transport and metabolism
|
|---|---|
| eggNOG description | PE-PGRS family |
| Orthologous group | COG0657 |
| Gene Ontology (46) |
GO:0003674, GO:0005488, GO:0005575, GO:0005618, GO:0005623, GO:0006950, GO:0008150, GO:0009405, GO:0009605, GO:0009607, GO:0009628, GO:0009987 +34 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate
| pN/pS | 0.634 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 3 missense, 0 nonsense, 2 frameshift |
| Disruption | 2 distinct premature-stop/frameshift site(s); most common in 3.20% of strains (4650) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
PGRS | PF21526.3 | 3.6e-08 | 15–89 | PGRS repeats |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: PE_PGRS60 (PE-PGRS family-related protein PE_PGRS60), high confidence from genomic context alone (score 781 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3652 PE_PGRS60 |
PE-PGRS family-related protein PE_PGRS60 | 781 | 781 ctx | neighborhood:781 |
Rv3354 hyp |
hypothetical protein | 693 | 674 | experimental:470 |
Rv3103c hyp |
hypothetical protein | 618 | 594 | experimental:512 |
Rv2564 glnQ |
glutamine ABC transporter ATP-binding protein | 614 | 578 | |
Rv0073 |
glutamine ABC transporter ATP-binding protein | 614 | 578 | |
Rv0986 |
adhesion component ABC transporter ATP-binding protein | 598 | 578 | |
Rv1077 cbs |
cystathionine beta-synthase | 806 | 59 | textmining:803 |
Rv1860 apa hyp |
hypothetical protein | 801 | 41 | textmining:801 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): PE-PGRS family-related protein PE_PGRS61
- Pfam (hmmscan --cut_ga): PGRS PF21526.3 (E=4e-08)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_178002.1)
- Domains: Pfam-A via hmmscan --cut_ga — PGRS (PF21526.3)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0657 - Curated reference: UniProt Q6MWV0 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
8 functional partner(s); context anchor
PE_PGRS60 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv3653|PE_PGRS61 MLNAPTQALLGRPLVGNGANGAPGTGANGGDGGILFGSGGAGGSGAAGMAGGNGGAAGLFGNGGAGGAGGSATAGAAGAGGNGGAGGLLFGTAGAGGNGGLSLGLGVAGGAGGAGGSGGSDTAGHGGTGGAGGLLFGAGEDGTTPGGNGGAGGVAGLFGDGGNGGNAGVGTPAGNVGAGGTGGLLLGQDGMTGLT