dppC Family assigned · medium auto-curated

H37Rv Rv3664c · MTBC0 - · 266 aa · 4103675–4104475 (-) · RefSeq NP_218181.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)dipeptide ABC transporter permease DppC
MTBC0 PGAP re-annotation
Revised (this work)Dipeptide ABC transporter permease DppC. Pfam: BPD_transp_1 (PF00528.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt L0TEV4 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable dipeptide-transport integral membrane protein ABC transporter DppC

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
P Inorganic ion transport and metabolism
Preferred namedppC
eggNOG descriptionABC transporter
Orthologous groupCOG1173
KEGG orthology K02034, K15582
KEGG pathways map01501, map02010, map02024
KEGG modules M00239, M00439

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.489 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
BPD_transp_1PF00528.28 5.4e-3279–261 Binding-protein-dependent transport system inner membrane component

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: dppB (dipeptide ABC transporter permease DppB), high confidence from genomic context alone (score 999 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3665c dppB dipeptide ABC transporter permease DppB 999 999 ctx neighborhood:807 cooccurence:774 coexpression:678 database:900 textmining:458
Rv3663c dppD dipeptide ABC transporter ATP-binding protein DppD 999 999 ctx neighborhood:882 fusion:478 cooccurence:773 coexpression:560 database:900 textmining:596
Rv3666c dppA dipeptide ABC transporter substrate-binding lipoprotein DppA 998 997 ctx neighborhood:807 cooccurence:768 coexpression:425 database:900 textmining:665
Rv1281c oppD oligopeptide ABC transporter ATP-binding protein OppD 978 971 ctx fusion:822 cooccurence:769
Rv1283c oppB oligopeptide ABC transporter permease OppB 981 937 ctx cooccurence:774 coexpression:670 textmining:711
Rv3662c hyp hypothetical protein 917 882 ctx neighborhood:881
Rv1280c oppA oligopeptide ABC transporter substrate-binding lipoprotein OppA 839 633 coexpression:429 textmining:580
Rv3667 acs acetyl-CoAsynthetase 552 553 ctx neighborhood:544
Rv2326c ABC transporter ATP-binding protein 590 552 coexpression:453
Rv2585c lipoprotein 586 525 coexpression:429
Rv1166 lpqW monoacyl phosphatidylinositol tetramannoside-binding protein LpqW 544 516 coexpression:432

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): dipeptide ABC transporter permease DppC
  • Pfam (hmmscan --cut_ga): BPD_transp_1 PF00528.28 (E=5e-32)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218181.1)
  • Domains: Pfam-A via hmmscan --cut_ga — BPD_transp_1 (PF00528.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1173
  • Curated reference: UniProt L0TEV4 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 11 functional partner(s); context anchor dppB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv3664c|dppC
MIAAALILLILVVAAFPSLFTAADPTYADPSQSMLAPSAAHWFGTDLQGHDIYSRTVYGARASVTVGLGATLAVFVVGGALGALAGFYGSWIDAVVSRVTDVFLGLPLLLAAIVLMQVMHHRTVWTVIAILALFGWPQVARIARGAVLEVRASDYVLAAKALGLNRFQILLRHALPNAVGPVIAVATVALGIFIVTEATLSYLGVGLPTSVVSWGGDINVAQTRLRSGSPILFYPAGALAITVLAFMMMGDALRDALDPASRAWRA