Rv0495c Family assigned · medium auto-curated

H37Rv Rv0495c · MTBC0 - · 296 aa · 585424–586314 (-) · RefSeq NP_215009.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Contains Rv0495c (PF11307.14) domain(s); putative function inferred from the domain architecture.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WKU5 SwissProt · reviewed · Evidence at protein level
UniProt nameProbable redox regulatory protein Rv0495c
Curated functionEssential for maintaining intracellular redox homeostasis. Could help overcome various host-induced stress conditions, ensure bacterial survival within macrophages and modulate in vivo growth of M.tuberculosis for long-term disease persistence.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group28IRH

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.426 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Rv0495cPF11307.14 2.4e-4170–278 Rv0495c-like

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0428c (GCN5-like N-acetyltransferase), high confidence from genomic context alone (score 738 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0499 hyp hypothetical protein 745 746 ctx neighborhood:744
Rv0428c GCN5-like N-acetyltransferase 737 738 ctx cooccurence:737
Rv0500 proC pyrroline-5-carboxylate reductase 737 737 ctx neighborhood:737
Rv2616 hyp hypothetical protein 660 661 ctx cooccurence:655
Rv3818 hyp hypothetical protein 644 644 ctx cooccurence:643
Rv0497 transmembrane protein 644 644 ctx neighborhood:639
Rv0496 ppx1 hyp hypothetical protein 643 643 ctx neighborhood:639
Rv2673 aftC alpha-(1->3)-arabinofuranosyltransferase 618 619 ctx cooccurence:617
Rv0498 hyp hypothetical protein 618 619 ctx neighborhood:617
Rv1845c blaR sensor-transducer protein BlaR 515 515 ctx cooccurence:504
Rv0500A DNA-binding protein 512 512 ctx neighborhood:430
Rv0487 hyp hypothetical protein 502 502 ctx cooccurence:488
Rv3802c membrane protein 485 486 ctx cooccurence:481
Rv2342 hyp hypothetical protein 473 474 ctx cooccurence:466
Rv3805c aftB terminal beta-(1->2)-arabinofuranosyltransferase 431 432 ctx cooccurence:428

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Pfam (hmmscan --cut_ga): Rv0495c PF11307.14 (E=2e-41)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215009.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Rv0495c (PF11307.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 28IRH
  • Curated reference: UniProt P9WKU5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 25 functional partner(s); context anchor Rv0428c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0495c|
MWRPAQGARWHVPAVLGYGGIPRRASWSNVESVANSRRRPVHPGQEVELDFAREWVEFYDPDNPEHLIAADLTWLLSRWACVFGTPACQGTVAGRPNDGCCSHGAFLSDDDDRTRLADAVHKLTDDDWQFRAKGLRRKGYLELDEHDGQPQHRTRKHKGACIFLNRPGFAGGAGCALHSKALKLGVPPLTMKPDVCWQLPIRRSQEWVTRPDGTEILKTTLTEYDRRGWGSGGADLHWYCTGDPAAHVGTKQVWQSLADELTELLGEKAYGELAAMCKRRSQLGLIAVHPATRAAQ