mce4F Family assigned · medium auto-curated
H37Rv Rv3494c · MTBC0 mtbc0_003709 ·
564 aa ·
3936257–3937951 MTBC0
(-) ·
RefSeq NP_218011.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | Mce family protein Mce4 |
|---|---|
| MTBC0 PGAP re-annotation | virulence factor Mce family protein |
| Revised (this work) | Virulence factor Mce family protein. Pfam: MlaD (PF02470.26). |
| Functional category (TubercuList) | virulence, detoxification, adaptation |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 3 publications
3 TB publications mention this gene. 3 publication(s) discuss this gene (3 in a M. tuberculosis context).
| Publication | Date |
|---|---|
| Global-scale GWAS associates a subset of SNPs with animal-adapted variants in M. tuberculosis complex. doi:10.1186/s12920-023-01695-5 | 2023 |
| Expression profile of mce4 operon of Mycobacterium tuberculosis following environmental stress. doi:10.1016/j.ijmyco.2016.08.004 | 2016 |
| Mce4F Mycobacterium tuberculosis protein peptides can inhibit invasion of human cell lines. doi:10.1093/femspd/ftu020 | 2015 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Intrinsic disorder (sequence + structure) partially disordered
| Predicted disorder | 19% of residues (metapredict) · mean AlphaFold pLDDT 74.8 |
|---|---|
| Disordered regions | 1 IDR(s), longest 139 aa [425-564] |
carries a substantial disordered region (139/564 residues); disorder is a property, not a function
A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).
Genomic-neighbour overlap (structural caveat) co-directional · 0 % of gene
| Neighbour | Rv3493c (Rv3493c, - strand) |
|---|---|
| Overlap | 1 bp, 0 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index 0.50 (95% CI -1.87 to 4.02). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Unknown, but thought to be involved in host cell invasion. Predicted to be involved in lipid catabolism. |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb3524c
· 99.8% identity |
|---|---|
| M. marinum |
MMAR_4982
· 83.7% identity |
| M. smegmatis |
MSMEG_5895
· 59.8% identity |
| M. orygis |
RJtmp_003599
· 100.0% identity |
| M. abscessus |
MAB_4148c
· 56.1% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
I6YC95
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Mce-family protein Mce4F |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
Q Secondary metabolites biosynthesis, transport and catabolism
|
|---|---|
| Preferred name | mce4F |
| eggNOG description | Virulence factor Mce family protein |
| Orthologous group | COG1463 |
| KEGG orthology |
K02067
|
| KEGG pathways |
map02010
|
| KEGG modules |
M00210, M00669, M00670
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 1.073 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 6 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 81.8%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 5/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 47.8% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis) cholesterol-required
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 26 in the ORF — 0 in the essential state, 0 growth-defect, 26 non-essential, 0 growth-advantage. Saturation 0.923, mean read count 170.458333333. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Cholesterol catabolism | required for growth on cholesterol (Griffin 2011) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Conditional fitness (RB-TnSeq, 95 conditions) carbon source
| Condition | Group | Direction | log2 fitness | t |
|---|---|---|---|---|
| cholesterol | carbon source | mutant depleted (gene required) | -1.869 | -7.871 |
Randomly-barcoded transposon screen across 95 carbon/nitrogen sources, pH, stressors and antibiotics (1 condition-specific phenotype(s) for this gene). A conditional fitness phenotype is a context lead, not a proven function, and never changes the verdict here. Note the blind spot: RB-TnSeq cannot measure essential genes. Source: RB-TnSeq 95-condition barcoded transposon screen, Mtb (PLoS Biol 2026, doi:10.1371/journal.pbio.3003529).
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| fitness on cholesterol (vs glycerol) (carbon source) | -7.25 | 0.0 | required |
| fitness in mouse infection (in vivo) | -2.74 | 0.0068 | required |
| fitness in mouse infection (in vivo) | -2.50 | 0.0 | required |
| fitness in mouse infection (in vivo) | -2.47 | 0.0 | required |
| fitness in mouse infection (in vivo) | -2.41 | 0.0053 | required |
| fitness in mouse infection (in vivo) | -2.23 | 0.0074 | required |
| fitness in mouse infection (in vivo) | -2.21 | 0.022 | required |
| fitness in mouse infection (in vivo) | -2.17 | 0.0068 | required |
| fitness in mouse infection (in vivo) | -2.11 | 0.0 | required |
| fitness in mouse infection (in vivo) | -2.11 | 0.048 | required |
| fitness in mouse infection (in vivo) | -2.11 | 0.023 | required |
| fitness in mouse infection (in vivo) | -2.09 | 0.0 | required |
Conditional fitness of transposon-disruption mutants across 41 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 10 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 28.9 ppm · rank 2094/3519 (40.5th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Predicted localisation (DeepTMHMM + lipobox)
| Prediction | predicted membrane protein (1 TM helix) |
|---|---|
| DeepTMHMM class | TM |
| TM helices (DeepTMHMM) | 1 |
Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.
Physico-chemical properties (computed, ProtParam)
| Length | 564 aa |
|---|---|
| Molecular weight | 59.6 kDa |
| Theoretical pI | 5.55 |
| GRAVY | -0.216 (hydrophilic) |
| Aliphatic index | 81.4 |
| Aromaticity | 0.069 |
| Instability index | 41.6 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
MlaD | PF02470.26 | 5.4e-19 | 39–114 | MlaD protein |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 74.8
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
8fee-assembly1_F |
1.00 | 0.41 | 3.2e-33 sig | 8fee-assembly1_F Structure of Mce1 transporter from Mycobacterium smegmatis in the absence of LucB (Map2) |
8fef-assembly1_E |
1.00 | 0.44 | 1.3e-15 sig | 8fef-assembly1_E Structure of Mce1 transporter from Mycobacterium smegmatis (Map0) |
8fee-assembly1_B |
1.00 | 0.42 | 6.1e-14 sig | 8fee-assembly1_B Structure of Mce1 transporter from Mycobacterium smegmatis in the absence of LucB (Map2) |
8fef-assembly1_D |
1.00 | 0.42 | 1.3e-13 sig | 8fef-assembly1_D Structure of Mce1 transporter from Mycobacterium smegmatis (Map0) |
8fee-assembly1_A |
1.00 | 0.40 | 3.3e-13 sig | 8fee-assembly1_A Structure of Mce1 transporter from Mycobacterium smegmatis in the absence of LucB (Map2) |
Foldseek search of the AlphaFold DB model (mean pLDDT 74.8, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 10
| Upstream (5' on genome) | Rv3493c (- strand, -1 bp gap) |
|---|---|
| Downstream (3' on genome) | lprN (- strand, 10 bp gap) |
| Predicted operon |
Rv3492c · Rv3493c · mce4F · lprN · mce4D · mce4C · mce4B · mce4A · yrbE4B · yrbE4A
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (6 TF) |
whiB5 (activates) · Rv0023 (represses) · Rv0324 (activates) · Rv0576 (represses) · Rv0767c (represses) · Rv3249c (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: mce4D (Mce family protein Mce4D), high confidence from genomic context alone (score 994 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3496c mce4D |
Mce family protein Mce4D | 998 | 994 ctx | neighborhood:879 cooccurence:769 coexpression:806 textmining:833 |
Rv3497c mce4C |
Mce family protein Mce4C | 999 | 993 ctx | neighborhood:879 cooccurence:766 coexpression:770 textmining:887 |
Rv3495c lprN |
Mce family lipoprotein LprN | 994 | 992 ctx | neighborhood:879 cooccurence:766 coexpression:730 |
Rv3498c mce4B |
Mce family protein Mce4B | 997 | 977 ctx | neighborhood:879 cooccurence:761 textmining:882 |
Rv3500c yrbE4B |
integral membrane protein | 995 | 977 ctx | neighborhood:856 cooccurence:736 textmining:815 |
Rv3492c |
Mce associated protein | 974 | 974 ctx | neighborhood:881 cooccurence:723 |
Rv3501c yrbE4A |
integral membrane protein | 993 | 967 ctx | neighborhood:813 cooccurence:704 textmining:807 |
Rv3499c mce4A |
Mce family protein Mce4A | 960 | 918 ctx | neighborhood:879 textmining:540 |
Rv3493c |
Mce associated protein | 905 | 905 ctx | neighborhood:881 |
Rv1965 yrbE3B |
integral membrane protein | 857 | 852 ctx | cooccurence:732 |
Rv0168 yrbE1B |
membrane protein | 850 | 845 ctx | cooccurence:710 |
Rv0588 yrbE2B hyp |
hypothetical protein | 848 | 842 ctx | cooccurence:714 |
Rv0167 yrbE1A |
membrane protein | 832 | 829 ctx | cooccurence:673 |
Rv0655 mkl exp |
ABC transporter ATP-binding protein | 891 | 826 ctx | cooccurence:636 experimental:431 textmining:400 |
Rv0587 yrbE2A hyp |
hypothetical protein | 827 | 824 ctx | cooccurence:672 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: Mce family protein Mce4
- MTBC0 PGAP product: virulence factor Mce family protein
- Pfam (hmmscan --cut_ga): MlaD PF02470.26 (E=5e-19)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218011.1)
- Domains: Pfam-A via hmmscan --cut_ga — MlaD (PF02470.26)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1463 - Curated reference: UniProt I6YC95 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 74.8)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
71 functional partner(s); context anchor
mce4D - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY); cholesterol requirement from Griffin et al. 2011 (doi:10.1371/journal.ppat.1002251)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003709|Rv3494c|mce4F MIDRLAKIQLSIFAVITVITLSVMAIFYLRLPATFGIGTYGVSADFVAGGGLYKNANVTYRGVAVGRVESVGLNPNGVTAHMRLNSGTAIPSNVTATVRSVSAIGEQYIDLVPPENPSSTKLRNGFRIQRQNTRIGQDVADLLRQAETLLGSLGDTRLRELLHEAFIATNGAGPELARLIESARLLVDEANANYPQVSQLIDQAGPFLQAQIRAGGDIKSLADGLARFTWQLRAADPRLRDTLADAPDAIDEANTAFSGIRPSFPALAASLANLGRVGVIYHKSIEQLLVVFPALFAAIITSAGGVPQDEGAKLDFKIDLHDPPPCMTGFLPPPLVRSPADESVREIPRDMYCKTAQNDPSTVRGARNYPCQEFPGKRAPTVQLCRDPRGYVPVGTNPWRGPPIPYGTEVTDGRNILPPNKFPYIPPGADPDPGVPIVGPPPPGQVAGPGPAPHQPAQPAPPPNDNGPPPPFTSWMPPGYPPEPPQVPYPATIPPPPPPEGTGPPPGPAPGPQPQASGPAYTIYDQLSGAFADPAGGTGIFAPGMTGASSAENWVDLMRDPRQL
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for mce4F? Email the maintainer — the message is pre-filled with this gene's details.