mce4F Family assigned · medium auto-curated

H37Rv Rv3494c · MTBC0 mtbc0_003709 · 564 aa · 3936257–3937951 (-) · RefSeq NP_218011.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)Mce family protein Mce4
MTBC0 PGAP re-annotationvirulence factor Mce family protein
Revised (this work)Virulence factor Mce family protein. Pfam: MlaD (PF02470.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6YC95 TrEMBL · unreviewed · Evidence at protein level
UniProt nameMce-family protein Mce4F

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category Q Secondary metabolites biosynthesis, transport and catabolism
Preferred namemce4F
eggNOG descriptionVirulence factor Mce family protein
Orthologous groupCOG1463
KEGG orthology K02067
KEGG pathways map02010
KEGG modules M00210, M00669, M00670

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.073 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
MlaDPF02470.26 5.4e-1939–114 MlaD protein

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: mce4D (Mce family protein Mce4D), high confidence from genomic context alone (score 994 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3496c mce4D Mce family protein Mce4D 998 994 ctx neighborhood:879 cooccurence:769 coexpression:806 textmining:833
Rv3497c mce4C Mce family protein Mce4C 999 993 ctx neighborhood:879 cooccurence:766 coexpression:770 textmining:887
Rv3495c lprN Mce family lipoprotein LprN 994 992 ctx neighborhood:879 cooccurence:766 coexpression:730
Rv3498c mce4B Mce family protein Mce4B 997 977 ctx neighborhood:879 cooccurence:761 textmining:882
Rv3500c yrbE4B integral membrane protein 995 977 ctx neighborhood:856 cooccurence:736 textmining:815
Rv3492c Mce associated protein 974 974 ctx neighborhood:881 cooccurence:723
Rv3501c yrbE4A integral membrane protein 993 967 ctx neighborhood:813 cooccurence:704 textmining:807
Rv3499c mce4A Mce family protein Mce4A 960 918 ctx neighborhood:879 textmining:540
Rv3493c Mce associated protein 905 905 ctx neighborhood:881
Rv1965 yrbE3B integral membrane protein 857 852 ctx cooccurence:732
Rv0168 yrbE1B membrane protein 850 845 ctx cooccurence:710
Rv0588 yrbE2B hyp hypothetical protein 848 842 ctx cooccurence:714
Rv0167 yrbE1A membrane protein 832 829 ctx cooccurence:673
Rv0655 mkl ABC transporter ATP-binding protein 891 826 ctx cooccurence:636 experimental:431 textmining:400
Rv0587 yrbE2A hyp hypothetical protein 827 824 ctx cooccurence:672

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: Mce family protein Mce4
  • MTBC0 PGAP product: virulence factor Mce family protein
  • Pfam (hmmscan --cut_ga): MlaD PF02470.26 (E=5e-19)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218011.1)
  • Domains: Pfam-A via hmmscan --cut_ga — MlaD (PF02470.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1463
  • Curated reference: UniProt I6YC95 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 71 functional partner(s); context anchor mce4D
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003709|Rv3494c|mce4F
MIDRLAKIQLSIFAVITVITLSVMAIFYLRLPATFGIGTYGVSADFVAGGGLYKNANVTYRGVAVGRVESVGLNPNGVTAHMRLNSGTAIPSNVTATVRSVSAIGEQYIDLVPPENPSSTKLRNGFRIQRQNTRIGQDVADLLRQAETLLGSLGDTRLRELLHEAFIATNGAGPELARLIESARLLVDEANANYPQVSQLIDQAGPFLQAQIRAGGDIKSLADGLARFTWQLRAADPRLRDTLADAPDAIDEANTAFSGIRPSFPALAASLANLGRVGVIYHKSIEQLLVVFPALFAAIITSAGGVPQDEGAKLDFKIDLHDPPPCMTGFLPPPLVRSPADESVREIPRDMYCKTAQNDPSTVRGARNYPCQEFPGKRAPTVQLCRDPRGYVPVGTNPWRGPPIPYGTEVTDGRNILPPNKFPYIPPGADPDPGVPIVGPPPPGQVAGPGPAPHQPAQPAPPPNDNGPPPPFTSWMPPGYPPEPPQVPYPATIPPPPPPEGTGPPPGPAPGPQPQASGPAYTIYDQLSGAFADPAGGTGIFAPGMTGASSAENWVDLMRDPRQL