Rv3213c Family assigned · medium auto-curated

H37Rv Rv3213c · MTBC0 mtbc0_003419 · 266 aa · 3612834–3613634 (-) · RefSeq NP_217729.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)SOJ/ParA-like protein
MTBC0 PGAP re-annotationAAA family ATPase
Revised (this work)AAA family ATPase. Pfam: AAA_31 (PF13614.13), ParA (PF10609.16), CBP_BcsQ (PF06564.19), CbiA (PF01656.30), ArsA_ATPase (PF02374.22), Fer4_NifH (PF00142.25).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O05853 TrEMBL · unreviewed · Evidence at protein level
UniProt namePossible SOJ/para-related protein
Curated functionMay play a role in septum formation.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category D Cell cycle control, cell division, chromosome partitioning
eggNOG descriptionchromosome partitioning
Orthologous groupCOG1192
KEGG orthology K03496

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.489 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
AAA_31PF13614.13 8.0e-545–178 AAA domain
ParAPF10609.16 9.7e-085–247 NUBPL iron-transfer P-loop NTPase
CBP_BcsQPF06564.19 9.0e-126–160 Cellulose biosynthesis protein BcsQ
CbiAPF01656.30 3.5e-267–230 CobQ/CobB/MinD/ParA nucleotide binding domain
ArsA_ATPasePF02374.22 7.7e-0912–135 Anion-transporting ATPase
Fer4_NifHPF00142.25 1.6e-0712–260 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: parB (chromosome partitioning protein ParB), high confidence from genomic context alone (score 924 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3917c parB chromosome partitioning protein ParB 941 924 ctx cooccurence:773 coexpression:477
Rv3215 entC isochorismate synthase 767 753 ctx neighborhood:752
Rv3214 gpm2 phosphoglycerate mutase 748 748 ctx neighborhood:744
Rv2647 hyp hypothetical protein 686 666 coexpression:471
Rv2748c ftsK DNA translocase FtsK 615 597 ctx cooccurence:580
Rv0001 dnaA chromosomal replication initiator protein DnaA 693 571
Rv2150c ftsZ cell division protein FtsZ 515 449 coexpression:430
Rv3014c ligA DNA ligase A 438 439 coexpression:420
Rv2580c hisS histidine--tRNA ligase 437 438 coexpression:419
Rv0904c accD3 acetyl-CoAcarboxylase carboxyl transferase subunit beta 428 428
Rv0018c pstP phosphoserine/threonine phosphatase PstP 444 427 coexpression:408
Rv2916c ffh signal recognition particle protein 413 414 coexpression:413
Rv1004c membrane protein 413 414 coexpression:413
Rv2764c thyA thymidylate synthase ThyA 412 412 coexpression:410
Rv2146c transmembrane protein 410 411 coexpression:411

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: SOJ/ParA-like protein
  • MTBC0 PGAP product: AAA family ATPase
  • Pfam (hmmscan --cut_ga): AAA_31 PF13614.13 (E=8e-54), ParA PF10609.16 (E=1e-07), CBP_BcsQ PF06564.19 (E=9e-12), CbiA PF01656.30 (E=3e-26), ArsA_ATPase PF02374.22 (E=8e-09), Fer4_NifH PF00142.25 (E=2e-07)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217729.1)
  • Domains: Pfam-A via hmmscan --cut_ga — AAA_31 (PF13614.13), ParA (PF10609.16), CBP_BcsQ (PF06564.19), CbiA (PF01656.30), ArsA_ATPase (PF02374.22), Fer4_NifH (PF00142.25)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1192
  • Curated reference: UniProt O05853 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 34 functional partner(s); context anchor parB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003419|Rv3213c|
MTDTRVLAVANQKGGVAKTTTVASLGAAMVEKGRRVLLVDLDPQGCLTFSLGQDPDKLPVSVHEVLLGEVEPNAVLVTTMEGMTLLPANIDLAGAEAMLLMRAGREYALKRALAKFSDRFDVVIIDCPPSLGVLTLNGLTAADEAIVPLQCEMLAHRGVGQFLRTVADVQQITNPNLRLLGALPTLYDSRTTHTRDVLLDVADRYDLQVLAPPIPRTVRFAEASASGSSVMAGRKNKGAVAYRELAQALLKHWKTGRPLPTFTVDL