Rv3213c Family assigned · medium auto-curated
H37Rv Rv3213c · MTBC0 mtbc0_003419 ·
266 aa · 3612834–3613634 (-) ·
RefSeq NP_217729.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | SOJ/ParA-like protein |
|---|---|
| MTBC0 PGAP re-annotation | AAA family ATPase |
| Revised (this work) | AAA family ATPase. Pfam: AAA_31 (PF13614.13), ParA (PF10609.16), CBP_BcsQ (PF06564.19), CbiA (PF01656.30), ArsA_ATPase (PF02374.22), Fer4_NifH (PF00142.25). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O05853
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Possible SOJ/para-related protein |
| Curated function | May play a role in septum formation. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
D Cell cycle control, cell division, chromosome partitioning
|
|---|---|
| eggNOG description | chromosome partitioning |
| Orthologous group | COG1192 |
| KEGG orthology |
K03496
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.489 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 4 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
AAA_31 | PF13614.13 | 8.0e-54 | 5–178 | AAA domain |
ParA | PF10609.16 | 9.7e-08 | 5–247 | NUBPL iron-transfer P-loop NTPase |
CBP_BcsQ | PF06564.19 | 9.0e-12 | 6–160 | Cellulose biosynthesis protein BcsQ |
CbiA | PF01656.30 | 3.5e-26 | 7–230 | CobQ/CobB/MinD/ParA nucleotide binding domain |
ArsA_ATPase | PF02374.22 | 7.7e-09 | 12–135 | Anion-transporting ATPase |
Fer4_NifH | PF00142.25 | 1.6e-07 | 12–260 | 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: parB (chromosome partitioning protein ParB), high confidence from genomic context alone (score 924 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3917c parB |
chromosome partitioning protein ParB | 941 | 924 ctx | cooccurence:773 coexpression:477 |
Rv3215 entC |
isochorismate synthase | 767 | 753 ctx | neighborhood:752 |
Rv3214 gpm2 |
phosphoglycerate mutase | 748 | 748 ctx | neighborhood:744 |
Rv2647 hyp |
hypothetical protein | 686 | 666 | coexpression:471 |
Rv2748c ftsK |
DNA translocase FtsK | 615 | 597 ctx | cooccurence:580 |
Rv0001 dnaA |
chromosomal replication initiator protein DnaA | 693 | 571 | |
Rv2150c ftsZ |
cell division protein FtsZ | 515 | 449 | coexpression:430 |
Rv3014c ligA |
DNA ligase A | 438 | 439 | coexpression:420 |
Rv2580c hisS |
histidine--tRNA ligase | 437 | 438 | coexpression:419 |
Rv0904c accD3 |
acetyl-CoAcarboxylase carboxyl transferase subunit beta | 428 | 428 | |
Rv0018c pstP |
phosphoserine/threonine phosphatase PstP | 444 | 427 | coexpression:408 |
Rv2916c ffh |
signal recognition particle protein | 413 | 414 | coexpression:413 |
Rv1004c |
membrane protein | 413 | 414 | coexpression:413 |
Rv2764c thyA |
thymidylate synthase ThyA | 412 | 412 | coexpression:410 |
Rv2146c |
transmembrane protein | 410 | 411 | coexpression:411 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: SOJ/ParA-like protein
- MTBC0 PGAP product: AAA family ATPase
- Pfam (hmmscan --cut_ga): AAA_31 PF13614.13 (E=8e-54), ParA PF10609.16 (E=1e-07), CBP_BcsQ PF06564.19 (E=9e-12), CbiA PF01656.30 (E=3e-26), ArsA_ATPase PF02374.22 (E=8e-09), Fer4_NifH PF00142.25 (E=2e-07)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217729.1)
- Domains: Pfam-A via hmmscan --cut_ga — AAA_31 (PF13614.13), ParA (PF10609.16), CBP_BcsQ (PF06564.19), CbiA (PF01656.30), ArsA_ATPase (PF02374.22), Fer4_NifH (PF00142.25)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1192 - Curated reference: UniProt O05853 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
34 functional partner(s); context anchor
parB - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003419|Rv3213c| MTDTRVLAVANQKGGVAKTTTVASLGAAMVEKGRRVLLVDLDPQGCLTFSLGQDPDKLPVSVHEVLLGEVEPNAVLVTTMEGMTLLPANIDLAGAEAMLLMRAGREYALKRALAKFSDRFDVVIIDCPPSLGVLTLNGLTAADEAIVPLQCEMLAHRGVGQFLRTVADVQQITNPNLRLLGALPTLYDSRTTHTRDVLLDVADRYDLQVLAPPIPRTVRFAEASASGSSVMAGRKNKGAVAYRELAQALLKHWKTGRPLPTFTVDL