Rv3226c Resolved · high auto-curated

H37Rv Rv3226c · MTBC0 mtbc0_003435 · 252 aa · 3624706–3625464 (-) · RefSeq NP_217743.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationSOS response-associated peptidase
Revised (this work)SOS response-associated peptidase. Pfam: SRAP (PF02586.20).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O05872 TrEMBL · unreviewed · Evidence at protein level
UniProt nameAbasic site processing protein
EC (curated) EC 3.4.-.-

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred nameyedK
eggNOG descriptionBelongs to the SOS response-associated peptidase family
Orthologous groupCOG2135

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.341 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
SRAPPF02586.20 2.3e-671–231 SOS response associated peptidase (SRAP)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: aroA (3-phosphoshikimate 1-carboxyvinyltransferase), high confidence from genomic context alone (score 788 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3227 aroA 3-phosphoshikimate 1-carboxyvinyltransferase 886 788 ctx neighborhood:787 textmining:485
Rv3228 rsgA hyp hypothetical protein 886 787 ctx neighborhood:787 textmining:489
Rv2894c xerC tyrosine recombinase XerC 775 767 coexpression:767
Rv3225c GCN5-like N-acetyltransferase 525 524 ctx neighborhood:507
Rv3781 rfbE O-antigen/lipopolysaccharide ABC transporter ATP-binding protein RfbE 469 470
Rv3242c hyp hypothetical protein 457 457 coexpression:457
Rv2646 integrase 456 436 coexpression:436
Rv2309c Rv2309c, (MTCY3G12.25), len: 151 aa. Possible integrase (fragment), similar to others e.g. Q48908 integrase (fragment) from Mycobacterium pa 456 436 coexpression:436
Rv2659c prophage integrase 455 435 coexpression:435
Rv1054 Rv1054, (MTV017.07), len: 104 aa. Probable integrase (fragment), similar to Rv2309c|MTCY3G12_25|Z79702 hypothetical protein (shows similarit 454 434 coexpression:434
Rv3751 Rv3751, (MTV025.099), len: 71 aa. Probable integrase (fragment), similar to part of many e.g. Q48908 integrase (fragment) from Mycobacterium 454 434 coexpression:434
Rv1701 xerD tyrosine recombinase XerD 454 434 coexpression:434

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: SOS response-associated peptidase
  • Pfam (hmmscan --cut_ga): SRAP PF02586.20 (E=2e-67)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217743.1)
  • Domains: Pfam-A via hmmscan --cut_ga — SRAP (PF02586.20)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2135
  • Curated reference: UniProt O05872 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 12 functional partner(s); context anchor aroA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003435|Rv3226c|
MCGRFAVTTDPAQLAEKITAIDEATGCGGGKTSYNVAPTDTIATVVSRHSEPDDEPTRRVRLMRWGLIPSWIKAGPGGAPDAKGPPLINARADKVATSPAFRSAVRSKRCLVPMDGWYEWRVDPDATPGRPNAKTPFFLHRHDGALLFTAGLWSVWKSYRSAPPLLSCTVITTDAVGELAEIHDRMPLLLAEEDWDDWLNPDAPPDPELLARPPDVRDIALRQVSTLVNNVRNNGPELLEPARSQPEQIQLL