crcB Resolved · high auto-curated

H37Rv Rv3069 · MTBC0 mtbc0_003262 · 132 aa · 3455056–3455454 (+) · RefSeq NP_217585.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)fluoride ion transporter CrcB
MTBC0 PGAP re-annotationfluoride efflux transporter CrcB
Revised (this work)Fluoride efflux transporter CrcB. Pfam: CRCB (PF02537.22).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WP63 SwissProt · reviewed · Evidence at protein level
UniProt nameFluoride-specific ion channel FluC 1
Curated functionFluoride-specific ion channel. Important for reducing fluoride concentration in the cell, thus reducing its toxicity.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category D Cell cycle control, cell division, chromosome partitioning
Preferred namecrcB
eggNOG descriptionImportant for reducing fluoride concentration in the cell, thus reducing its toxicity
Orthologous groupCOG0239
KEGG orthology K06199
Gene Ontology (33) GO:0003674, GO:0005215, GO:0005575, GO:0005623, GO:0005886, GO:0005887, GO:0006810, GO:0006811, GO:0006820, GO:0008150, GO:0008509, GO:0015075 +21 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.768 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
CRCBPF02537.22 3.1e-2811–120 CrcB-like protein, Camphor Resistance (CrcB)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: crcB (fluoride ion transporter CrcB), high confidence from genomic context alone (score 986 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3070 crcB fluoride ion transporter CrcB 989 986 ctx neighborhood:882 cooccurence:773 coexpression:524
Rv3071 hyp hypothetical protein 936 926 ctx neighborhood:881 cooccurence:402
Rv3068c pgmA phosphoglucomutase PgmA 787 787 ctx neighborhood:785
Rv1022 lpqU lipoprotein LpqU 886 165 textmining:870
Rv1280c oppA oligopeptide ABC transporter substrate-binding lipoprotein OppA 569 155 textmining:511
Rv0418 lpqL lipoprotein aminopeptidase LpqL 656 49 textmining:654
Rv0361 membrane protein 870 47 textmining:870
Rv1733c transmembrane protein 513 47 textmining:510
Rv0200 transmembrane protein 752 46 textmining:751
Rv0556 transmembrane protein 870 44 textmining:870
Rv3630 integral membrane protein 861 44 textmining:861
Rv0835 lpqQ lipoprotein LpqQ 860 41 textmining:860
Rv0403c mmpS1 membrane protein MmpS1 753 41 textmining:753
Rv0178 Mce associated membrane protein 629 41 textmining:629

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: fluoride ion transporter CrcB
  • MTBC0 PGAP product: fluoride efflux transporter CrcB
  • Pfam (hmmscan --cut_ga): CRCB PF02537.22 (E=3e-28)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217585.1)
  • Domains: Pfam-A via hmmscan --cut_ga — CRCB (PF02537.22)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0239
  • Curated reference: UniProt P9WP63 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 14 functional partner(s); context anchor crcB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003262|Rv3069|crcB
MPNHDYRELAAVFAGGALGALARAALSALAIPDPARWPWPTFTVNVVGAFLVGYFTTRLLERLPLSSYRRPLLGTGLCGGLTTFSTMQVETISMIEHGHWGLAAAYSVVSITLGLLAVHLATVLVRRVRIRR