hab Resolved · high auto-curated

H37Rv Rv3078 · MTBC0 mtbc0_003272 · 133 aa · 3462717–3463118 (+) · RefSeq NP_217594.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hydroxylaminobenzene mutase
MTBC0 PGAP re-annotationhydrogenase
Revised (this work)Hydrogenase. Pfam: SOI (PF26512.2).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6Y2H3 TrEMBL · unreviewed · Predicted
UniProt nameProbable hydroxylaminobenzene mutase Hab

Functional vocabulary (eggNOG-mapper, orthology transfer)

Preferred namehab
Orthologous group2C945
EC number EC 5.4.4.1
KEGG orthology K01865
KEGG pathways map00627, map01120

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.243 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
SOIPF26512.2 1.3e-261–133 Styrene oxide isomerase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3077 (hydrolase), high confidence from genomic context alone (score 785 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3076 hyp hypothetical protein 883 883 ctx neighborhood:882
Rv3077 hydrolase 786 785 ctx neighborhood:773
Rv3075c hyp hypothetical protein 597 597 ctx neighborhood:596
Rv2856 nicT nickel-transport integral membrane protein NicT 416 47 textmining:413

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hydroxylaminobenzene mutase
  • MTBC0 PGAP product: hydrogenase
  • Pfam (hmmscan --cut_ga): SOI PF26512.2 (E=1e-26)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217594.1)
  • Domains: Pfam-A via hmmscan --cut_ga — SOI (PF26512.2)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2C945
  • Curated reference: UniProt I6Y2H3 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 4 functional partner(s); context anchor Rv3077
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003272|Rv3078|hab
MQKLLFTIGLALFLIGLLTGLVIPALKNPRMALSSHLEGVLNGMFLVVLGLLWPHIDLPEAWQVIAVALIVYSAYANWLATLLAAAWGAGRKFAPIATGDHKAPAAKEGFVSFLLLSLSVAIVIGVVIVIIGL