adhC Resolved · high auto-curated
H37Rv Rv3045 · MTBC0 mtbc0_003237 ·
346 aa · 3427595–3428635 (+) ·
RefSeq NP_217561.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | NADP-dependent alcohol dehydrogenase |
|---|---|
| MTBC0 PGAP re-annotation | NAD(P)-dependent alcohol dehydrogenase |
| Revised (this work) | NAD(P)-dependent alcohol dehydrogenase. Pfam: ADH_N (PF08240.18), ADH_zinc_N (PF00107.33). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WQC5
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | NADP-dependent alcohol dehydrogenase C |
| EC (curated) |
EC 1.1.1.2
|
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| Preferred name | adhC |
| eggNOG description | alcohol dehydrogenase |
| Orthologous group | COG1064 |
| KEGG orthology |
K13979
|
| Gene Ontology (13) |
GO:0005575, GO:0005618, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886, GO:0016020, GO:0030312, GO:0044424, GO:0044444, GO:0044464 +1 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.066 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 5 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
ADH_N | PF08240.18 | 2.9e-28 | 27–146 | Alcohol dehydrogenase GroES-like domain |
ADH_zinc_N | PF00107.33 | 1.3e-18 | 185–307 | Zinc-binding dehydrogenase |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: fecB (FeIII-dicitrate-binding periplasmic lipoprotein), medium confidence from genomic context alone (score 637 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0147 |
aldehyde dehydrogenase | 938 | 914 | database:900 |
Rv3293 pcd |
piperideine-6-carboxylic acid dehydrogenase | 917 | 913 | database:900 |
Rv0223c |
aldehyde dehydrogenase | 936 | 912 | database:900 |
Rv0458 |
aldehyde dehydrogenase | 927 | 912 | database:900 |
Rv0768 aldA |
aldehyde dehydrogenase AldA | 916 | 912 | database:900 |
Rv3696c glpK |
glycerol kinase | 916 | 911 | database:900 |
Rv1692 |
phosphatase | 900 | 900 | database:900 |
Rv3044 fecB |
FeIII-dicitrate-binding periplasmic lipoprotein | 650 | 637 ctx | neighborhood:626 |
Rv0761c adhB |
alcohol dehydrogenase B | 563 | 537 | |
Rv3086 adhD |
alcohol dehydrogenase D | 553 | 526 | |
Rv0162c adhE1 |
zinc-type alcohol dehydrogenase subunit E | 548 | 521 | |
Rv2259 mscR |
S-nitrosomycothiol reductase MscR | 543 | 516 | |
Rv0408 pta |
phosphate acetyltransferase | 564 | 505 | coexpression:494 |
Rv3043c ctaD |
cytochrome C oxidase cytochrome 1 | 474 | 450 ctx | neighborhood:411 |
Rv1530 adh |
alcohol dehydrogenase | 458 | 431 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: NADP-dependent alcohol dehydrogenase
- MTBC0 PGAP product: NAD(P)-dependent alcohol dehydrogenase
- Pfam (hmmscan --cut_ga): ADH_N PF08240.18 (E=3e-28), ADH_zinc_N PF00107.33 (E=1e-18)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217561.1)
- Domains: Pfam-A via hmmscan --cut_ga — ADH_N (PF08240.18), ADH_zinc_N (PF00107.33)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1064 - Curated reference: UniProt P9WQC5 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
24 functional partner(s); context anchor
fecB - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003237|Rv3045|adhC MSTVAAYAAMSATEPLTKTTITRRDPGPHDVAIDIKFAGICHSDIHTVKAEWGQPNYPVVPGHEIAGVVTAVGSEVTKYRQGDRVGVGCFVDSCRECNSCTRGIEQYCKPGANFTYNSIGKDGQPTQGGYSEAIVVDENYVLRIPDVLPLDVAAPLLCAGITLYSPLRHWNAGANTRVAIIGLGGLGHMGVKLGAAMGADVTVLSQSLKKMEDGLRLGAKSYYATADPDTFRKLRGGFDLILNTVSANLDLGQYLNLLDVDGTLVELGIPEHPMAVPAFALALMRRSLAGSNIGGIAETQEMLNFCAEHGVTPEIELIEPDYINDAYERVLASDVRYRFVIDISAL