adhC Resolved · high auto-curated

H37Rv Rv3045 · MTBC0 mtbc0_003237 · 346 aa · 3427595–3428635 (+) · RefSeq NP_217561.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)NADP-dependent alcohol dehydrogenase
MTBC0 PGAP re-annotationNAD(P)-dependent alcohol dehydrogenase
Revised (this work)NAD(P)-dependent alcohol dehydrogenase. Pfam: ADH_N (PF08240.18), ADH_zinc_N (PF00107.33).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WQC5 SwissProt · reviewed · Evidence at protein level
UniProt nameNADP-dependent alcohol dehydrogenase C
EC (curated) EC 1.1.1.2

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred nameadhC
eggNOG descriptionalcohol dehydrogenase
Orthologous groupCOG1064
KEGG orthology K13979
Gene Ontology (13) GO:0005575, GO:0005618, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886, GO:0016020, GO:0030312, GO:0044424, GO:0044444, GO:0044464 +1 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.066 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ADH_NPF08240.18 2.9e-2827–146 Alcohol dehydrogenase GroES-like domain
ADH_zinc_NPF00107.33 1.3e-18185–307 Zinc-binding dehydrogenase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: fecB (FeIII-dicitrate-binding periplasmic lipoprotein), medium confidence from genomic context alone (score 637 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0147 aldehyde dehydrogenase 938 914 database:900
Rv3293 pcd piperideine-6-carboxylic acid dehydrogenase 917 913 database:900
Rv0223c aldehyde dehydrogenase 936 912 database:900
Rv0458 aldehyde dehydrogenase 927 912 database:900
Rv0768 aldA aldehyde dehydrogenase AldA 916 912 database:900
Rv3696c glpK glycerol kinase 916 911 database:900
Rv1692 phosphatase 900 900 database:900
Rv3044 fecB FeIII-dicitrate-binding periplasmic lipoprotein 650 637 ctx neighborhood:626
Rv0761c adhB alcohol dehydrogenase B 563 537
Rv3086 adhD alcohol dehydrogenase D 553 526
Rv0162c adhE1 zinc-type alcohol dehydrogenase subunit E 548 521
Rv2259 mscR S-nitrosomycothiol reductase MscR 543 516
Rv0408 pta phosphate acetyltransferase 564 505 coexpression:494
Rv3043c ctaD cytochrome C oxidase cytochrome 1 474 450 ctx neighborhood:411
Rv1530 adh alcohol dehydrogenase 458 431

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: NADP-dependent alcohol dehydrogenase
  • MTBC0 PGAP product: NAD(P)-dependent alcohol dehydrogenase
  • Pfam (hmmscan --cut_ga): ADH_N PF08240.18 (E=3e-28), ADH_zinc_N PF00107.33 (E=1e-18)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217561.1)
  • Domains: Pfam-A via hmmscan --cut_ga — ADH_N (PF08240.18), ADH_zinc_N (PF00107.33)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1064
  • Curated reference: UniProt P9WQC5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 24 functional partner(s); context anchor fecB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003237|Rv3045|adhC
MSTVAAYAAMSATEPLTKTTITRRDPGPHDVAIDIKFAGICHSDIHTVKAEWGQPNYPVVPGHEIAGVVTAVGSEVTKYRQGDRVGVGCFVDSCRECNSCTRGIEQYCKPGANFTYNSIGKDGQPTQGGYSEAIVVDENYVLRIPDVLPLDVAAPLLCAGITLYSPLRHWNAGANTRVAIIGLGGLGHMGVKLGAAMGADVTVLSQSLKKMEDGLRLGAKSYYATADPDTFRKLRGGFDLILNTVSANLDLGQYLNLLDVDGTLVELGIPEHPMAVPAFALALMRRSLAGSNIGGIAETQEMLNFCAEHGVTPEIELIEPDYINDAYERVLASDVRYRFVIDISAL