Rv3046c Family assigned · medium

H37Rv Rv3046c · MTBC0 mtbc0_003238 · 124 aa · 3428624–3428998 (-) · RefSeq NP_217562.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationDUF3349 domain-containing protein
Revised (this work)Member of the DUF3349 (PF11829) protein superfamily, predominant in Mycobacterium and Rhodococcus. RefSeq leaves it 'hypothetical protein'. The AlphaFold model superposes on the solved DUF3349 structure MSMEG_1053 (PDB 2lky; Foldseek prob 1.0, E 2e-4), a five-alpha-helix bundle; same superfamily as Rv0543c (already curated). Genus-restricted fold of unknown biochemical function.

Curated reference (UniProt)

UniProt I6YF16 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionProtein of unknown function (DUF3349)
Orthologous group2E7QJ

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.704 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF3349PF11829.14 4.2e-299–105 Protein of unknown function (DUF3349)

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 59.6 (low). Low-confidence model: the fold may be unreliable, so treat these structural hits with caution.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
2kvc-assembly1_A 1.00 0.67 3.0e-04 sig 2kvc-assembly1_A Solution structure of the Mycobacterium tuberculosis protein Rv0543c, a member of the DUF3349 superfamily. Seattle Structural Genomics Center for Infectious Disease target MytuD.17112.a
2lky-assembly1_A 1.00 0.60 3.0e-04 sig 2lky-assembly1_A Solution structure of MSMEG_1053, the second DUF3349 annotated protein in the genome of Mycobacterium smegmatis, Seattle Structural Genomics Center for Infectious Disease target MysmA.17112.b
6zmt-assembly1_S 0.06 0.25 3.1e+00 6zmt-assembly1_S SARS-CoV-2 Nsp1 bound to a pre-40S-like ribosome complex
8yho-assembly1_C 0.04 0.32 9.0e+00 8yho-assembly1_C Cryo-EM structure of the trimeric HerA
2cpt-assembly1_A 0.03 0.17 2.9e+00 2cpt-assembly1_A Solution structure of MIT domain from human SKD1
7xiv-assembly1_B 0.02 0.22 7.3e+00 7xiv-assembly1_B Structural insight into the interactions between Lloviu virus VP30 and nucleoprotein
6zka-assembly1_Y 0.02 0.19 7.3e+00 6zka-assembly1_Y Membrane domain of open complex I during turnover
7zdj-assembly1_Y 0.02 0.20 9.6e+00 7zdj-assembly1_Y Complex I from Ovis aries at pH5.5, Open state

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: papA3 (acyltransferase papA3), medium confidence from genomic context alone (score 436 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3256c hyp hypothetical protein 483 483 ctx cooccurence:480
Rv0184 hyp hypothetical protein 476 476 ctx cooccurence:476
Rv0185 hyp hypothetical protein 447 448 ctx cooccurence:446
Rv3847 hyp hypothetical protein 445 445 ctx cooccurence:440
Rv1182 papA3 acyltransferase papA3 435 436 ctx cooccurence:432
Rv3047c hyp hypothetical protein 416 416 ctx neighborhood:416
Rv3824c papA1 acyltransferase 409 410 ctx cooccurence:408
Rv3454 Rv3454, (MTCY13E12.07), len: 422 aa. Probable conserved integral membrane protein, showing some similarity to various proteins (generally tr 406 406 ctx cooccurence:406
Rv3820c papA2 trehalose-2-sulfate acyltransferase 403 404 ctx cooccurence:402

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Pfam DUF3349 (PF11829)
  • Foldseek -> DUF3349 structure MSMEG_1053 (2lky), prob 1.0, E 2e-4
  • Same superfamily as Rv0543c (lit-crible)
  • Structural homology: AlphaFold DB model + Foldseek vs PDB (project 'Still unknown gene function', phase5-7, 2026-06-10). A fold-level family assignment, not a demonstrated activity.

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217562.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF3349 (PF11829.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2E7QJ
  • Curated reference: UniProt I6YF16 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 59.6, low)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 9 functional partner(s); context anchor papA3
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003238|Rv3046c|
MTKTFSHPHFFRSVLRWLQVGYPEGVPGPDRVALLSLLRSTPLTEEQIGEVVRHFTENGSPAVADRVIDRDEIAEFISEVTHHDAGPENIQRVAGILAAAGWPLAGVDVGESESGSDRAPASQG