Rv2968c Family assigned · medium auto-curated

H37Rv Rv2968c · MTBC0 mtbc0_003152 · 210 aa · 3344246–3344878 (-) · RefSeq NP_217484.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)integral membrane protein
MTBC0 PGAP re-annotationvitamin K epoxide reductase family protein
Revised (this work)Vitamin K epoxide reductase family protein. Pfam: VKOR (PF07884.20).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6X5W1 TrEMBL · unreviewed · Inferred from homology
UniProt nameProbable conserved integral membrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionVitamin K epoxide reductase
Orthologous groupCOG4243

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
VKORPF07884.20 8.3e-4424–156 Vitamin K epoxide reductase family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: lipN (lipase/esterase LipN), high confidence from genomic context alone (score 781 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2969c hyp hypothetical protein 991 938 ctx neighborhood:881 textmining:870
Rv2970c lipN lipase/esterase LipN 780 781 ctx neighborhood:775
Rv2967c pca pyruvate carboxylase 742 742 ctx neighborhood:738
Rv2966c rsmD methyltransferase 693 694 ctx neighborhood:689
Rv2970A hyp hypothetical protein 641 642 ctx neighborhood:640
Rv2971 oxidoreductase 528 528 ctx neighborhood:521
Rv2874 dipZ integral membrane C-type cytochrome biogenesis protein DipZ 447 223
Rv0526 thioredoxin 838 198 textmining:807
Rv1677 dsbF lipoprotein DsbF 428 184
Rv3673c membrane-anchored thioredoxin-like protein 609 178 textmining:545
Rv0816c thiX thioredoxin ThiX 598 160 textmining:542
Rv0527 ccdA cytochrome C-type biogenesis protein CcdA 698 82 textmining:685
Rv0529 ccsA cytochrome C-type biogenesis protein CcsA 549 47 textmining:547

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: integral membrane protein
  • MTBC0 PGAP product: vitamin K epoxide reductase family protein
  • Pfam (hmmscan --cut_ga): VKOR PF07884.20 (E=8e-44)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217484.1)
  • Domains: Pfam-A via hmmscan --cut_ga — VKOR (PF07884.20)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG4243
  • Curated reference: UniProt I6X5W1 (TrEMBL, unreviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 13 functional partner(s); context anchor lipN
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003152|Rv2968c|
MVAARPAERSGDPAAVRVPVPSAWWVLIGGVIGLFASMTLTVEKVRILLDPIYVPSCNVNPIVSCGSVMTTPQASLLGFPNPLLGIAGFTVVVVTGVLAVAKVPLPRWYWIGLAVGILVGVAFVHWLIFQSLYRIGALCPYCMVVWAVIATLLVVVASIVFGPMRENRGSQERVGARLLYQWRWSLATLWFTTVFLLIMVRFWDYWSTLI