lipN Resolved · high auto-curated

H37Rv Rv2970c · MTBC0 mtbc0_003154 · 376 aa · 3345748–3346878 MTBC0 (-) · RefSeq NP_217486.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)lipase/esterase LipN
MTBC0 PGAP re-annotationlipase/esterase LipN
Revised (this work)Lipase/esterase LipN. Pfam: BD-FAE (PF20434.6), Abhydrolase_3 (PF07859.20).
Functional category (TubercuList)intermediary metabolism and respiration

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 14 publications

14 TB publications mention this gene. 14 publication(s) discuss this gene (12 in a M. tuberculosis context).

Most recent 5 of 14.
PublicationDate
Proteomic Analysis and Sequential Events During the in-vivo Acquisition of Drug Resistance in Clinical Isolates of Mycobacterium tuberculosis. doi:10.2174/0118715265356091250519032548 2025
Acupuncture as adjunctive treatment for linezolid-induced peripheral neuropathy: a case series report. doi:10.3389/fneur.2024.1388544 2024
Sequence and Structural Motifs Controlling the Broad Substrate Specificity of the Mycobacterial Hormone-Sensitive Lipase LipN. doi:10.1021/acsomega.3c00534 2023
Case report: Significant relief of linezolid-induced peripheral neuropathy in a pre-XDR-TB case after acupuncture treatment. doi:10.3389/fneur.2022.985499 2022
Evaluation of 5 Novel protein biomarkers for the rapid diagnosis of pulmonary and extra-pulmonary tuberculosis: preliminary results. doi:10.1038/srep44121 2017

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

CRISPRi vulnerability

Vulnerability index 1.37 (95% CI -0.45 to 4.46). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, supplementary Table S2 'mmc3.xlsx', bulk import via Europe PMC -- supersedes the per-gene pebble.rockefeller.edu scrape of phase46_crispri_vulnerability.py).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionFunction unknown; lipolytic enzyme involved in cellular metabolism.
Mycobrowser EC 3.1.1.- · agrees with the atlas

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb2994c · 100.0% identity
M. marinum MMAR_1746 · 72.1% identity
M. smegmatis MSMEG_2409 · 55.4% identity
M. orygis RJtmp_003064 · 100.0% identity
M. abscessus MAB_3270c · 55.9% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P95125 SwissProt · reviewed · Evidence at protein level
UniProt nameCarboxylic ester hydrolase LipN
EC (curated) EC 3.1.1.-
Curated functionNon specific carboxylic ester hydrolase. Hydrolyzes various pNP-esters, with a preference for short carbon chain substrates. Can also hydrolyze tributyrin to di- and monobutyrin and 4-hydroxyphenylacetate to hydroquinone.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
Preferred namelipN
eggNOG descriptionAlpha beta hydrolase
Orthologous groupCOG0657
KEGG orthology K01066

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.258 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 7 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Bacteria

M. canettii dN/dS (deep-divergence selection) 0.0 (low power) · 1 consensus substitution(s)
low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 52/53 (98%) · mean identity 72.6% · 4/4 closest MTBAP relatives
conserved across the genus (present in 52/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 9/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 40.5%
detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 17 in the ORF — 0 in the essential state, 0 growth-defect, 17 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 137. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.
All 17 sites lie in this ORF alone (no overlapping CDS shares any), so the call is attributable to this gene.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Enzyme activity (activity-based protein profiling) active serine hydrolase confirms atlas call high-confidence target

Directly labelled by a fluorophosphonate activity-based probe in live M. tuberculosis: biochemical proof that this protein is a catalytically active serine hydrolase, not merely a predicted fold. This experimentally corroborates the atlas assignment (Lipase/esterase LipN. Pfam: BD-FAE (PF20434.6), Abhydrolase_3 (PF07859.20).), which was derived independently from structure and orthology.

Active / prioritized atpH 5.0 (growth condition)
Active under hypoxiayes (non-replicating persistence relevant)
Covalent-inhibitor targetLalistat, CyC17 (chemically addressable active site)

experimental (activity-based) confirmation of the atlas serine-hydrolase family assignment; proves the enzyme is catalytically active in live M. tuberculosis. It never changes the verdict here. Source: Li M, Patel HV, ..., Canaan S, Aldridge BB et al., Cell Chem Biol 2021 (PMC8964833; doi:10.1016/j.chembiol.2021.09.002); competitive activity-based protein profiling of FP-reactive serine hydrolases.

Proteomics (mass spectrometry) detected

MS detectiondetected in 12 of 16 independent MS datasets
Integrated abundance176.0 ppm · rank 913/3519 (74.1th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length376 aa
Molecular weight40.1 kDa
Theoretical pI5.93
GRAVY0.001 (hydrophobic)
Aliphatic index95.3
Aromaticity0.069
Instability index30.9 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
BD-FAEPF20434.6 1.1e-15130–230 BD-FAE
Abhydrolase_3PF07859.20 1.1e-71137–349 alpha/beta hydrolase fold

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 89.9

PDB hitprobTM-scoreE-valueDescription
4ypv-assembly1_A 1.00 0.93 2.1e-35 sig 4ypv-assembly1_A High-resolution structure of a metagenome-derived esterase Est8
8yfz-assembly1_A-2 1.00 0.94 1.7e-30 sig 8yfz-assembly1_A-2 CRYSTAL STRUCTURE OF THE EST1 H274E MUTANT AT PH 4.2
5lk6-assembly2_D 1.00 0.91 1.2e-30 sig 5lk6-assembly2_D Crystal structure of a lipase carboxylesterase from Sulfolobus islandicus
5jd4-assembly3_C 1.00 0.87 4.0e-32 sig 5jd4-assembly3_C Crystal structure of LAE6 Ser161Ala mutant, an alpha/beta hydrolase enzyme from the metagenome of Lake Arreo, Spain
6rky-assembly2_D 1.00 0.88 5.1e-32 sig 6rky-assembly2_D STRUCTURE OF ESTER-HYDROLASE EH1AB1 FROM THE METAGENOME OF LAKE ARREO COMPLEXED WITH A DERIVATIVE OF BIPYRIDINE PHOSPHONATE

Foldseek search of the AlphaFold DB model (mean pLDDT 89.9, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon)

Upstream (5' on genome)Rv2969c (- strand, 96 bp gap)
Downstream (3' on genome)Rv2970A (+ strand, 230 bp gap)

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: Rv2968c (integral membrane protein), high confidence from genomic context alone (score 781 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2969c hyp hypothetical protein 785 785 ctx neighborhood:775
Rv2968c integral membrane protein 780 781 ctx neighborhood:775
Rv2970A hyp hypothetical protein 769 765 ctx neighborhood:748
Rv2967c pca pyruvate carboxylase 763 764 ctx neighborhood:756
Rv2971 oxidoreductase 734 729 ctx neighborhood:713
Rv2966c rsmD methyltransferase 675 675 ctx neighborhood:670
Rv3097c lipY triacylglycerol lipase Lip 751 576 ctx cooccurence:576 textmining:437
Rv0722 rpmD exp 50S ribosomal protein L30 495 496 database:490
Rv2903c lepB exp signal peptidase 506 488 database:464
Rv2284 lipM esterase LipM 892 480 ctx cooccurence:475 textmining:802
Rv0310c hyp exp hypothetical protein 477 474 experimental:439
Rv2485c lipQ carboxylesterase LipQ 743 473 ctx cooccurence:470 textmining:534
Rv3153 nuoI exp NADH-quinone oxidoreductase subunit I 456 456 experimental:440
Rv3151 nuoG exp NADH-quinone oxidoreductase subunit G 477 453 experimental:441
Rv3150 nuoF exp NADH-quinone oxidoreductase subunit F 449 449 experimental:441

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: lipase/esterase LipN
  • MTBC0 PGAP product: lipase/esterase LipN
  • Pfam (hmmscan --cut_ga): BD-FAE PF20434.6 (E=1e-15), Abhydrolase_3 PF07859.20 (E=1e-71)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217486.1)
  • Domains: Pfam-A via hmmscan --cut_ga — BD-FAE (PF20434.6), Abhydrolase_3 (PF07859.20)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0657
  • Curated reference: UniProt P95125 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 89.9)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 47 functional partner(s); context anchor Rv2968c
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003154|Rv2970c|lipN
MTKSLPGVADLRLGANHPRMWTRRVQGTVVNVGVKVLPWIPTPAKRILSAGRSVIIDGNTLDPTLQLMLSTSRIFGVDGLAVDDDIVASRAHMRAICEAMPGPQIHVDVTDLSIPGPAGEIPARHYRPSGGGATPLLVFYHGGGWTLGDLDTHDALCRLTCRDADIQVLSIDYRLAPEHPAPAAVEDAYAAFVWAHEHASDEFGALPGRVAVGGDSAGGNLSAVVCQLARDKARYEGGPTPVLQWLLYPRTDFTAQTRSMGLFGNGFLLTKRDIDWFHTQYLRDSDVDPADPRLSPLLAESLSGLAPALIAVAGFDPLRDEGESYAKALRAAGTAVDLRYLGSLTHGFLNLFQLGGGSAAGTNELISALRAHLSRV