Rv2581c Resolved · high auto-curated
H37Rv Rv2581c · MTBC0 mtbc0_002748 ·
224 aa · 2929633–2930307 (-) ·
RefSeq NP_217097.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | glyoxalase II |
|---|---|
| MTBC0 PGAP re-annotation | MBL fold metallo-hydrolase |
| Revised (this work) | MBL fold metallo-hydrolase. Pfam: Lactamase_B (PF00753.34). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WMW3
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Uncharacterized protein Rv2581c |
| EC (curated) |
EC 3.-.-.-
|
UniProt still lists this protein as Uncharacterized protein Rv2581c; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Zn-dependent |
| Orthologous group | COG0491 |
| EC number |
EC 3.1.2.6
|
| KEGG orthology |
K01069
|
| KEGG pathways |
map00620
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.528 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Lactamase_B | PF00753.34 | 5.2e-32 | 9–203 | Metallo-beta-lactamase superfamily |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: hisS (histidine--tRNA ligase), high confidence from genomic context alone (score 888 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2580c hisS |
histidine--tRNA ligase | 888 | 888 ctx | neighborhood:882 |
Rv2582 ppiB |
peptidyl-prolyl cis-trans isomerase B | 651 | 650 ctx | neighborhood:644 |
Rv0331 |
dehydrogenase/reductase | 651 | 636 | database:583 |
Rv3455c truA |
tRNA pseudouridine synthase A | 423 | 401 | |
Rv2165c rsmH |
rRNA small subunit methyltransferase H | 400 | 400 | |
Rv2367c ybeY |
endoribonuclease | 425 | 398 | |
Rv0390 hyp |
hypothetical protein | 659 | 294 | textmining:537 |
Rv1066 hyp |
hypothetical protein | 658 | 293 | textmining:537 |
Rv2047c hyp |
hypothetical protein | 501 | 84 | textmining:478 |
Rv1672c |
integral membrane transport protein | 492 | 68 | textmining:478 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: glyoxalase II
- MTBC0 PGAP product: MBL fold metallo-hydrolase
- Pfam (hmmscan --cut_ga): Lactamase_B PF00753.34 (E=5e-32)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217097.1)
- Domains: Pfam-A via hmmscan --cut_ga — Lactamase_B (PF00753.34)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0491 - Curated reference: UniProt P9WMW3 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
10 functional partner(s); context anchor
hisS - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002748|Rv2581c| MLITGFPAGLLACNCYVLAERPGTDAVIVDPGQGAMGTLRRILDKNRLTPAAVLLTHGHIDHIWSAQKVSDTFGCPTYVHPADRFMLTDPIYGLGPRIAQLVAGAFFREPKQVVELDRDGDKIDLGGISVNIDHTPGHTRGSVVFRVLQATNNDKDIVFTGDTLFERAIGRTDLAGGSGRDLLRSIVDKLLVLDDSTVVLPGHGNSTTIGAERRFNPFLEGLSR