hisS Resolved · high auto-curated

H37Rv Rv2580c · MTBC0 mtbc0_002747 · 423 aa · 2928365–2929636 MTBC0 (-) · RefSeq NP_217096.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)histidine--tRNA ligase
MTBC0 PGAP re-annotationhistidine--tRNA ligase
Revised (this work)Histidine--tRNA ligase. Pfam: tRNA-synt_His (PF13393.12), tRNA-synt_2b (PF00587.31), HGTP_anticodon (PF03129.26).
Functional category (TubercuList)information pathways

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 4 publications

4 TB publications mention this gene. 4 publication(s) discuss this gene (4 in a M. tuberculosis context).

PublicationDate
A reservoir at the gates: nonhuman mammalian hosts for human schistosomiasis in western Africa and the critical challenge for elimination. doi:10.1186/s40249-025-01394-6 2026
Genomic analysis of the 2017 Aotearoa New Zealand outbreak of Mycoplasma bovis and its position within the global population structure. doi:10.3389/fmicb.2025.1600146 2025
[CHRONIC DESTRUCTIVE PULMONARY TUBERCULOSIS WITH DISTURBANCE OF RHYTHM AND CONDUCTION OF THE HEART]. 2015
The reality of health information systems: challenges for standardization. 2008

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Genomic-neighbour overlap (structural caveat) co-directional · 0 % of gene

NeighbourRv2581c (Rv2581c, - strand)
Overlap4 bp, 0 % of this gene's length

co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.

CRISPRi vulnerability

Vulnerability index -11.98 (95% CI -13.58 to -10.54). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionInvolved in translation mechamism [catalytic activity: ATP + L-histidine + tRNA(his) = AMP + pyrophosphate + L-histidyl-tRNA(his)].
Mycobrowser EC 6.1.1.21 · agrees with the atlas

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb2611c · 99.8% identity
M. leprae ML0494 · 85.9% identity
M. marinum MMAR_2127 · 92.3% identity
M. smegmatis MSMEG_2976 · 83.7% identity
M. orygis RJtmp_002671 · 99.8% identity
M. abscessus MAB_2872c · 80.3% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WFV5 SwissProt · reviewed · Evidence at protein level
UniProt nameHistidine--tRNA ligase
EC (curated) EC 6.1.1.21

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namehisS
eggNOG descriptionhistidyl-tRNA synthetase
Orthologous groupCOG0124
EC number EC 6.1.1.21
KEGG orthology K01892
KEGG pathways map00970
KEGG modules M00359, M00360
Gene Ontology (10) GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0008150, GO:0016020, GO:0030312, GO:0040007, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.288 · purifying
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Bacteria

Genus-wide presence (~53 non-MTBC Mycobacterium) present in 53/53 (100%) · mean identity 89.4% · 4/4 closest MTBAP relatives
conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 10/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 67.8%
detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis) essential

DeJesus 2017 callES · essential
What the call meansessential: insertions absent across the whole ORF
TA sites (Himar1) 19 in the ORF — 19 in the essential state, 0 growth-defect, 0 non-essential, 0 growth-advantage. Saturation 0.000, mean read count 0. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 13 of 16 independent MS datasets
Integrated abundance115.0 ppm · rank 1198/3519 (66.0th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length423 aa
Molecular weight45.1 kDa
Theoretical pI5.34
GRAVY-0.038 (hydrophilic)
Aliphatic index94.1
Aromaticity0.069
Instability index35.9 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
tRNA-synt_HisPF13393.12 7.2e-3712–310 Histidyl-tRNA synthetase
tRNA-synt_2bPF00587.31 1.3e-1470–298 tRNA synthetase class II core domain (G, H, P, S and T)
HGTP_anticodonPF03129.26 1.6e-16330–418 Anticodon binding domain

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 94.5

PDB hitprobTM-scoreE-valueDescription
4e51-assembly1_A 1.00 0.93 1.9e-45 sig 4e51-assembly1_A Crystal structure of a histidyl-tRNA synthetase HisRS from Burkholderia thailandensis bound to histidine
1adj-assembly1_A 1.00 0.86 5.8e-47 sig 1adj-assembly1_A HISTIDYL-TRNA SYNTHETASE IN COMPLEX WITH HISTIDINE
2el9-assembly1_B 1.00 0.92 1.5e-43 sig 2el9-assembly1_B Crystal structure of E.coli Histidyl-tRNA synthetase complexed with a histidyl-adenylate analogue
4rdx-assembly1_A-2 1.00 0.86 1.9e-44 sig 4rdx-assembly1_A-2 Structure of histidinyl-tRNA synthetase in complex with tRNA(His)
1kmn-assembly2_C 1.00 0.91 5.2e-43 sig 1kmn-assembly2_C HISTIDYL-TRNA SYNTHETASE COMPLEXED WITH HISTIDINOL AND ATP

Foldseek search of the AlphaFold DB model (mean pLDDT 94.5, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 2

Upstream (5' on genome)dhaA (+ strand, 279 bp gap)
Downstream (3' on genome)Rv2581c (- strand, -4 bp gap)
Predicted operon hisS · Rv2581c

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: Rv2581c (glyoxalase II), high confidence from genomic context alone (score 888 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2581c glyoxalase II 888 888 ctx neighborhood:882
Rv2572c aspS aspartate--tRNA ligase 877 836 coexpression:808
Rv2121c hisG exp ATP phosphoribosyltransferase 864 822 experimental:790
Rv2448c valS valine--tRNA ligase 967 678 coexpression:426 textmining:903
Rv2868c gcpE 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 712 676 coexpression:649
Rv2582 ppiB peptidyl-prolyl cis-trans isomerase B 661 648 ctx neighborhood:644
Rv2555c alaS alanine--tRNA ligase 712 624 coexpression:517
Rv2614c thrS threonine--tRNA ligase 960 588 coexpression:427 textmining:908
Rv3396c guaA GMP synthase 773 580 coexpression:422 textmining:484
Rv3264c manB D-alpha-D-mannose-1-phosphate guanylyltransferase ManB 624 573 ctx cooccurence:454
Rv3598c lysS lysine--tRNA ligase 738 565 textmining:423
Rv1640c lysX bifunctional lysine--tRNA ligase/phosphatidylglycerol lysyltransferase 678 547
Rv1292 argS arginine--tRNA ligase 942 543 coexpression:403 textmining:879
Rv2540c aroF chorismate synthase 514 515 coexpression:498
Rv3580c cysS1 cysteine--tRNA ligase 841 501 coexpression:423 textmining:696

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: histidine--tRNA ligase
  • MTBC0 PGAP product: histidine--tRNA ligase
  • Pfam (hmmscan --cut_ga): tRNA-synt_His PF13393.12 (E=7e-37), tRNA-synt_2b PF00587.31 (E=1e-14), HGTP_anticodon PF03129.26 (E=2e-16)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217096.1)
  • Domains: Pfam-A via hmmscan --cut_ga — tRNA-synt_His (PF13393.12), tRNA-synt_2b (PF00587.31), HGTP_anticodon (PF03129.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0124
  • Curated reference: UniProt P9WFV5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 94.5)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 95 functional partner(s); context anchor Rv2581c
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002747|Rv2580c|hisS
MTEFSSFSAPKGVPDYVPPDSAQFVAVRDGLLAAARQAGYSHIELPIFEDTALFARGVGESTDVVSKEMYTFADRGDRSVTLRPEGTAGVVRAVIEHGLDRGALPVKLCYAGPFFRYERPQAGRYRQLQQVGVEAIGVDDPALDAEVIAIADAGFRSLGLDGFRLEITSLGDESCRPQYRELLQEFLFGLDLDEDTRRRAGINPLRVLDDKRPELRAMTASAPVLLDHLSDVAKQHFDTVLAHLDALGVPYVINPRMVRGLDYYTKTAFEFVHDGLGAQSGIGGGGRYDGLMHQLGGQDLSGIGFGLGVDRTVLALRAEGKTAGDSARCDVFGVPLGEAAKLRLAVLAGRLRAAGVRVDLAYGDRGLKGAMRAAARSGARVALVAGDRDIEAGTVAVKDLTTGEQVSVSMDSVVAEVISRLAG