hisS Resolved · high auto-curated

H37Rv Rv2580c · MTBC0 mtbc0_002747 · 423 aa · 2928365–2929636 (-) · RefSeq NP_217096.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)histidine--tRNA ligase
MTBC0 PGAP re-annotationhistidine--tRNA ligase
Revised (this work)Histidine--tRNA ligase. Pfam: tRNA-synt_His (PF13393.12), tRNA-synt_2b (PF00587.31), HGTP_anticodon (PF03129.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WFV5 SwissProt · reviewed · Evidence at protein level
UniProt nameHistidine--tRNA ligase
EC (curated) EC 6.1.1.21

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namehisS
eggNOG descriptionhistidyl-tRNA synthetase
Orthologous groupCOG0124
EC number EC 6.1.1.21
KEGG orthology K01892
KEGG pathways map00970
KEGG modules M00359, M00360
Gene Ontology (10) GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0008150, GO:0016020, GO:0030312, GO:0040007, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.288 · purifying
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
tRNA-synt_HisPF13393.12 7.2e-3712–310 Histidyl-tRNA synthetase
tRNA-synt_2bPF00587.31 1.3e-1470–298 tRNA synthetase class II core domain (G, H, P, S and T)
HGTP_anticodonPF03129.26 1.6e-16330–418 Anticodon binding domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2581c (glyoxalase II), high confidence from genomic context alone (score 888 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2581c glyoxalase II 888 888 ctx neighborhood:882
Rv2572c aspS aspartate--tRNA ligase 877 836 coexpression:808
Rv2121c hisG ATP phosphoribosyltransferase 864 822 experimental:790
Rv2448c valS valine--tRNA ligase 967 678 coexpression:426 textmining:903
Rv2868c gcpE 4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) 712 676 coexpression:649
Rv2582 ppiB peptidyl-prolyl cis-trans isomerase B 661 648 ctx neighborhood:644
Rv2555c alaS alanine--tRNA ligase 712 624 coexpression:517
Rv2614c thrS threonine--tRNA ligase 960 588 coexpression:427 textmining:908
Rv3396c guaA GMP synthase 773 580 coexpression:422 textmining:484
Rv3264c manB D-alpha-D-mannose-1-phosphate guanylyltransferase ManB 624 573 ctx cooccurence:454
Rv3598c lysS lysine--tRNA ligase 738 565 textmining:423
Rv1640c lysX bifunctional lysine--tRNA ligase/phosphatidylglycerol lysyltransferase 678 547
Rv1292 argS arginine--tRNA ligase 942 543 coexpression:403 textmining:879
Rv2540c aroF chorismate synthase 514 515 coexpression:498
Rv3580c cysS1 cysteine--tRNA ligase 841 501 coexpression:423 textmining:696

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: histidine--tRNA ligase
  • MTBC0 PGAP product: histidine--tRNA ligase
  • Pfam (hmmscan --cut_ga): tRNA-synt_His PF13393.12 (E=7e-37), tRNA-synt_2b PF00587.31 (E=1e-14), HGTP_anticodon PF03129.26 (E=2e-16)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217096.1)
  • Domains: Pfam-A via hmmscan --cut_ga — tRNA-synt_His (PF13393.12), tRNA-synt_2b (PF00587.31), HGTP_anticodon (PF03129.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0124
  • Curated reference: UniProt P9WFV5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 95 functional partner(s); context anchor Rv2581c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002747|Rv2580c|hisS
MTEFSSFSAPKGVPDYVPPDSAQFVAVRDGLLAAARQAGYSHIELPIFEDTALFARGVGESTDVVSKEMYTFADRGDRSVTLRPEGTAGVVRAVIEHGLDRGALPVKLCYAGPFFRYERPQAGRYRQLQQVGVEAIGVDDPALDAEVIAIADAGFRSLGLDGFRLEITSLGDESCRPQYRELLQEFLFGLDLDEDTRRRAGINPLRVLDDKRPELRAMTASAPVLLDHLSDVAKQHFDTVLAHLDALGVPYVINPRMVRGLDYYTKTAFEFVHDGLGAQSGIGGGGRYDGLMHQLGGQDLSGIGFGLGVDRTVLALRAEGKTAGDSARCDVFGVPLGEAAKLRLAVLAGRLRAAGVRVDLAYGDRGLKGAMRAAARSGARVALVAGDRDIEAGTVAVKDLTTGEQVSVSMDSVVAEVISRLAG