lipU Resolved · high auto-curated

H37Rv Rv1076 · MTBC0 - · 297 aa · 1200767–1201660 (+) · RefSeq NP_215592.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)lipase LipU
MTBC0 PGAP re-annotation
Revised (this work)Lipase LipU. Pfam: BD-FAE (PF20434.6), Say1_Mug180 (PF10340.16), Abhydrolase_3 (PF07859.20).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt O53424 SwissProt · reviewed · Evidence at protein level
UniProt nameEsterase LipU
EC (curated) EC 3.1.1.-
Curated functionEsterase that shows preference for short chain fatty acids. Contributes to the growth of M.tuberculosis during the nutritive stress. Elicits strong humoral response in both extrapulmonary and relapsed cases of tuberculosis patients.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
Preferred namelipU
eggNOG descriptionAlpha beta hydrolase
Orthologous groupCOG0657

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.484 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
BD-FAEPF20434.6 5.1e-0862–151 BD-FAE
Say1_Mug180PF10340.16 2.2e-0865–184 Steryl acetyl hydrolase
Abhydrolase_3PF07859.20 1.3e-4566–272 alpha/beta hydrolase fold

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: cbs (cystathionine beta-synthase), high confidence from genomic context alone (score 864 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1077 cbs cystathionine beta-synthase 865 864 ctx neighborhood:804
Rv3097c lipY triacylglycerol lipase Lip 880 755 ctx cooccurence:755 textmining:533
Rv1075c hyp hypothetical protein 718 706 ctx neighborhood:614
Rv1078 pra hyp hypothetical protein 661 661 ctx neighborhood:659
Rv0722 rpmD 50S ribosomal protein L30 491 492 database:490
Rv1074c fadA3 beta-ketoacyl CoA thiolase FadA 488 486 ctx neighborhood:468
Rv2903c lepB signal peptidase 502 483 database:464
Rv0310c hyp hypothetical protein 480 477 experimental:439
Rv0220 lipC esterase LipC 810 473 ctx cooccurence:471 textmining:656
Rv3153 nuoI NADH-quinone oxidoreductase subunit I 468 453 experimental:440
Rv3151 nuoG NADH-quinone oxidoreductase subunit G 472 449 experimental:441
Rv3149 nuoE NADH-quinone oxidoreductase subunit E 446 444 experimental:440
Rv3150 nuoF NADH-quinone oxidoreductase subunit F 444 444 experimental:441
Rv2195 qcrA ubiquinol-cytochrome C reductase rieske iron-sulfur subunit 462 436 experimental:426
Rv2946c pks1 polyketide synthase 473 421

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): lipase LipU
  • Pfam (hmmscan --cut_ga): BD-FAE PF20434.6 (E=5e-08), Say1_Mug180 PF10340.16 (E=2e-08), Abhydrolase_3 PF07859.20 (E=1e-45)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215592.1)
  • Domains: Pfam-A via hmmscan --cut_ga — BD-FAE (PF20434.6), Say1_Mug180 (PF10340.16), Abhydrolase_3 (PF07859.20)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0657
  • Curated reference: UniProt O53424 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 49 functional partner(s); context anchor cbs
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv1076|lipU
MAVRPVLAVGSYLPHAPWPWGVIDQAARVLLPASTTVRAAVSLPNASAQLVRASGVLPADGTRRAVLYLHGGAFLTCGANSHGRLVELLSKFADSPVLVVDYRLIPKHSIGMALDDCHDGYRWLRLLGYEPEQIVLAGDSAGGYLALALAQRLQEVGEEPAALVAISPLLQLAKEHKQAHPNIKTDAMFPARAFDALDALVASAAARNQVDGEPEELYEPLEHITPGLPRTLIHVSGSEVLLHDAQLAAAKLAAAGVPAEVRVWPGQVHDFQVAASMLPEAIRSLRQIGEYIREATG