Rv2117 Family assigned · low auto-curated · to review

H37Rv Rv2117 · MTBC0 mtbc0_002249 · 97 aa · 2404411–2404704 (+) · RefSeq NP_216633.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationDUF503 domain-containing protein
Revised (this work)DUF503 domain-containing protein.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed (flagged for human review).

Curated reference (UniProt)

UniProt O33252 TrEMBL · unreviewed · Evidence at protein level
UniProt nameDUF503 domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionProtein of unknown function (DUF503)
Orthologous groupCOG1550
KEGG orthology K09764

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF503PF04456.18 1.9e-303–89 Protein of unknown function (DUF503)

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 91.5 (very high). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
1j27-assembly1_A 1.00 0.94 1.4e-08 sig 1j27-assembly1_A Crystal structure of a hypothetical protein, TT1725, from Thermus thermophilus HB8 at 1.7A resolution
7b90-assembly1_E 1.00 0.69 3.8e-04 sig 7b90-assembly1_E Circular permutant of ribosomal protein S6, P54-55 truncated, I8A mutant
1q8b-assembly1_A 1.00 0.57 9.9e-04 sig 1q8b-assembly1_A Structural Genomics, protein YJCS
3kg1-assembly3_A-2 1.00 0.52 5.0e-04 sig 3kg1-assembly3_A-2 Crystal structure of SnoaB, a cofactor-independent oxygenase from Streptomyces nogalater, mutant N63A
1wd6-assembly1_B 1.00 0.58 3.6e-03 sig 1wd6-assembly1_B crystal structure of JW1657 from Escherichia coli
6wi5-assembly2_B 1.00 0.59 2.7e-03 sig 6wi5-assembly2_B De novo designed protein Foldit4
2n76-assembly1_A 1.00 0.54 2.2e-03 sig 2n76-assembly1_A Solution NMR Structure of De novo designed protein LFR1 1 with ferredoxin fold, Northeast Structural Genomics Consortium (NESG) Target OR414
3kng-assembly1_B 0.99 0.50 1.7e-03 sig 3kng-assembly1_B Crystal structure of SnoaB, a cofactor-independent oxygenase from Streptomyces nogalater, determined to 1.9 resolution

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: lppK (lipoprotein LppK), high confidence from genomic context alone (score 884 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2116 lppK lipoprotein LppK 884 884 ctx neighborhood:882
Rv2115c mpa proteasome-associated ATPase 726 726 ctx neighborhood:726
Rv2838c rbfA ribosome-binding factor RbfA 714 695 coexpression:644
Rv2839c infB translation initiation factor IF-2 607 581 coexpression:511
Rv2840c hyp hypothetical protein 420 421

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: DUF503 domain-containing protein
  • Pfam (hmmscan --cut_ga): DUF503 PF04456.18 (E=2e-30)
  • Foldseek best: 1j27-assembly1_A Crystal structure of a hypothetical protein, TT1725, from Therm (prob 1.00, E=1e-08, TM=0.94)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216633.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF503 (PF04456.18)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1550
  • Curated reference: UniProt O33252 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 91.5, very high)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 5 functional partner(s); context anchor lppK
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002249|Rv2117|
MWIGWLEFDVLLGDVRSLKQKRSVTRPLVAELQRKFSVSAAETGSHDLYRRAGIGVAVVSGDRSHAVDVLDNAERLVAAHPEFELLSVRRGLHRTDD