Rv1813c Family assigned · low

H37Rv Rv1813c · MTBC0 mtbc0_001925 · 143 aa · 2073692–2074123 (-) · RefSeq NP_216329.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationDUF4189 domain-containing protein
Revised (this work)DUF4189; structure solved (PDB 7NHZ, Rv1813c); secreted DUF4189-family protein.

Curated reference (UniProt)

UniProt P9WLS1 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv1813c

UniProt still lists this protein as Uncharacterized protein Rv1813c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionDomain of unknown function (DUF4189)
Orthologous group2DE1B

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.347 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF4189PF13827.12 2.2e-1458–142 Domain of unknown function (DUF4189)

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 91.7 (very high). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
7nhz-assembly1_A 1.00 0.67 7.1e-15 sig 7nhz-assembly1_A NMR structure of Rv1813c from Mycobacterium tuberculosis
2z3i-assembly1_D 0.07 0.51 7.8e+00 2z3i-assembly1_D Crystal structure of blasticidin S deaminase (BSD) mutant E56Q complexed with substrate
2z3j-assembly1_D 0.05 0.35 6.1e+00 2z3j-assembly1_D Crystal structure of blasticidin S deaminase (BSD) R90K mutant
5x8t-assembly1_S 0.04 0.24 5.1e+00 5x8t-assembly1_S Structure of the 50S large subunit of chloroplast ribosome from spinach
2z3g-assembly1_B 0.04 0.35 7.8e+00 2z3g-assembly1_B Crystal structure of blasticidin S deaminase (BSD)
4kq0-assembly1_D 0.02 0.24 7.8e+00 4kq0-assembly1_D Crystal structure of double-helical CGG-repetitive RNA 19mer complexed with RSS p19

Functional interaction network (STRING v12, guilt-by-association)

PartnerProductScoreNo text-miningChannels (≥400)
Rv2623 TB31.7 universal stress protein 836 836 coexpression:836
Rv2032 acg NAD(P)H nitroreductase 901 834 coexpression:833 textmining:433
Rv3134c universal stress protein 859 829 coexpression:829
Rv2627c hyp hypothetical protein 828 828 coexpression:827
Rv1733c transmembrane protein 865 819 coexpression:819
Rv2626c hrp1 hypoxic response protein 851 813 coexpression:813
Rv2031c hspX alpha-crystallin 864 808 coexpression:808
Rv1996 universal stress protein 805 805 coexpression:805
Rv2007c fdxA ferredoxin 864 801 coexpression:801
Rv3131 NAD(P)H nitroreductase 844 801 coexpression:800
Rv2030c hyp hypothetical protein 904 800 coexpression:800 textmining:541
Rv3127 hyp hypothetical protein 897 800 coexpression:799 textmining:510
Rv1737c narK2 nitrate/nitrite transporter 833 798 coexpression:793
Rv3130c tgs1 diacyglycerol O-acyltransferase 818 767 coexpression:767
Rv1738 hyp hypothetical protein 828 738 coexpression:738

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • MTBC0 PGAP product: DUF4189 domain-containing protein
  • Pfam: DUF4189 PF13827.12
  • Foldseek best: 7nhz-assembly1_A NMR structure of Rv1813c from Mycobacterium tuberculosis (prob 1.00, E=7e-15, TM=0.67)
  • (structure-only promotion reviewed by hand, 2026-06-01)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216329.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF4189 (PF13827.12)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2DE1B
  • Curated reference: UniProt P9WLS1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 91.7, very high)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 31 functional partner(s)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001925|Rv1813c|
MITNLRRRTAMAAAGLGAALGLGILLVPTVDAHLANGSMSEVMMSEIAGLPIPPIIHYGAIAYAPSGASGKAWHQRTPARAEQVALEKCGDKTCKVVSRFTRCGAVAYNGSKYQGGTGLTRRAAEDDAVNRLEGGRIVNWACN