Rv1813c Family assigned · low
H37Rv Rv1813c · MTBC0 mtbc0_001925 ·
143 aa · 2073692–2074123 (-) ·
RefSeq NP_216329.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | DUF4189 domain-containing protein |
| Revised (this work) | DUF4189; structure solved (PDB 7NHZ, Rv1813c); secreted DUF4189-family protein. |
Curated reference (UniProt)
| UniProt |
P9WLS1
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Uncharacterized protein Rv1813c |
UniProt still lists this protein as Uncharacterized protein Rv1813c; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Domain of unknown function (DUF4189) |
| Orthologous group | 2DE1B |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.347 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
DUF4189 | PF13827.12 | 2.2e-14 | 58–142 | Domain of unknown function (DUF4189) |
Structural neighbours (Foldseek on the ESMFold model, exploratory)
ESMFold model confidence: mean pLDDT 91.7 (very high). A confident model makes the fold comparison meaningful.
Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.
| Target | Prob | TM | E-value | Description |
|---|---|---|---|---|
7nhz-assembly1_A |
1.00 | 0.67 | 7.1e-15 sig | 7nhz-assembly1_A NMR structure of Rv1813c from Mycobacterium tuberculosis |
2z3i-assembly1_D |
0.07 | 0.51 | 7.8e+00 | 2z3i-assembly1_D Crystal structure of blasticidin S deaminase (BSD) mutant E56Q complexed with substrate |
2z3j-assembly1_D |
0.05 | 0.35 | 6.1e+00 | 2z3j-assembly1_D Crystal structure of blasticidin S deaminase (BSD) R90K mutant |
5x8t-assembly1_S |
0.04 | 0.24 | 5.1e+00 | 5x8t-assembly1_S Structure of the 50S large subunit of chloroplast ribosome from spinach |
2z3g-assembly1_B |
0.04 | 0.35 | 7.8e+00 | 2z3g-assembly1_B Crystal structure of blasticidin S deaminase (BSD) |
4kq0-assembly1_D |
0.02 | 0.24 | 7.8e+00 | 4kq0-assembly1_D Crystal structure of double-helical CGG-repetitive RNA 19mer complexed with RSS p19 |
Functional interaction network (STRING v12, guilt-by-association)
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2623 TB31.7 |
universal stress protein | 836 | 836 | coexpression:836 |
Rv2032 acg |
NAD(P)H nitroreductase | 901 | 834 | coexpression:833 textmining:433 |
Rv3134c |
universal stress protein | 859 | 829 | coexpression:829 |
Rv2627c hyp |
hypothetical protein | 828 | 828 | coexpression:827 |
Rv1733c |
transmembrane protein | 865 | 819 | coexpression:819 |
Rv2626c hrp1 |
hypoxic response protein | 851 | 813 | coexpression:813 |
Rv2031c hspX |
alpha-crystallin | 864 | 808 | coexpression:808 |
Rv1996 |
universal stress protein | 805 | 805 | coexpression:805 |
Rv2007c fdxA |
ferredoxin | 864 | 801 | coexpression:801 |
Rv3131 |
NAD(P)H nitroreductase | 844 | 801 | coexpression:800 |
Rv2030c hyp |
hypothetical protein | 904 | 800 | coexpression:800 textmining:541 |
Rv3127 hyp |
hypothetical protein | 897 | 800 | coexpression:799 textmining:510 |
Rv1737c narK2 |
nitrate/nitrite transporter | 833 | 798 | coexpression:793 |
Rv3130c tgs1 |
diacyglycerol O-acyltransferase | 818 | 767 | coexpression:767 |
Rv1738 hyp |
hypothetical protein | 828 | 738 | coexpression:738 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- MTBC0 PGAP product: DUF4189 domain-containing protein
- Pfam: DUF4189 PF13827.12
- Foldseek best: 7nhz-assembly1_A NMR structure of Rv1813c from Mycobacterium tuberculosis (prob 1.00, E=7e-15, TM=0.67)
- (structure-only promotion reviewed by hand, 2026-06-01)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216329.1)
- Domains: Pfam-A via hmmscan --cut_ga — DUF4189 (PF13827.12)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2DE1B - Curated reference: UniProt P9WLS1 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Model confidence: ESMFold per-residue pLDDT (mean 91.7, very high)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 31 functional partner(s)
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001925|Rv1813c| MITNLRRRTAMAAAGLGAALGLGILLVPTVDAHLANGSMSEVMMSEIAGLPIPPIIHYGAIAYAPSGASGKAWHQRTPARAEQVALEKCGDKTCKVVSRFTRCGAVAYNGSKYQGGTGLTRRAAEDDAVNRLEGGRIVNWACN