Rv1813c Family assigned · low
H37Rv Rv1813c · MTBC0 mtbc0_001925 ·
143 aa ·
2073692–2074123 MTBC0
(-) ·
RefSeq NP_216329.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | DUF4189 domain-containing protein |
| Revised (this work) | DUF4189; structure solved (PDB 7NHZ, Rv1813c); secreted DUF4189-family protein. |
| Functional category (TubercuList) | conserved hypotheticals |
In the literature (TB corpus sweep) 10 publications
Found under: H37Rv (10).
10 TB publications mention this gene. 10 publication(s) mention this gene (title/abstract), verified against the text. The atlas states the function; these are the primary sources that discuss it.
| Publication | Date |
|---|---|
| Novel Multistage Subunit Mycobacterium tuberculosis Nanoparticle Vaccine Confers Protection Against Experimental Infection in Prophylactic and Therapeutic Regimens. doi:10.3390/vaccines14010005 | 2025 |
| A Mycobacterium tuberculosis Effector Targets Mitochondrion, Controls Energy Metabolism, and Limits Cytochrome c Exit. doi:10.1128/spectrum.01066-23 | 2023 |
| Preventive effects of Mycobacterium tuberculosis DNA vaccines on the mouse model with latent tuberculosis infection. doi:10.3389/fimmu.2023.1110843 | 2023 |
| B21 DNA vaccine expressing ag85b, rv2029c, and rv1738 confers a robust therapeutic effect against latent Mycobacterium tuberculosis infection. doi:10.3389/fimmu.2022.1025931 | 2022 |
| Prediction and analyses of HLA-II restricted Mycobacterium tuberculosis CD4+ T cell epitopes in the Chinese population. doi:10.1002/bab.2171 | 2022 |
This layer CITES the literature, it does not change the verdict or the function. A gene may be heavily studied (as an antigen, a resistance determinant, a drug target) while its molecular function is settled elsewhere in the fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole), MULTI-ALIAS sweep: H37Rv locus tag AND every ortholog identifier (M. bovis Mb…, M. marinum MMAR_…, M. smegmatis MSMEG_…, M. leprae ML…, M. abscessus MAB_…), each hit VERIFIED against the abstract text (word-boundary regex). phase73/phase75, 2026-07-13.
Intrinsic disorder (sequence + structure) partially disordered
| Predicted disorder | 23% of residues (metapredict) · mean AlphaFold pLDDT 82.1 |
|---|---|
| Disordered regions | 1 IDR(s), longest 34 aa [0-34] |
carries a substantial disordered region (34/143 residues); disorder is a property, not a function
A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).
Conditional expression context (iModulons)
Member of 2 independently-modulated gene set(s):
DevR-1 (devR), RicR (ricR).
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
CRISPRi vulnerability
Vulnerability index 0.61 (95% CI -0.47 to 2.25). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Function unknown |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb1843c
· 100.0% identity |
|---|---|
| M. marinum |
MMAR_2533
· 53.2% identity |
| M. orygis |
RJtmp_001881
· 100.0% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WLS1
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Uncharacterized protein Rv1813c |
UniProt still lists this protein as Uncharacterized protein Rv1813c; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Domain of unknown function (DUF4189) |
| Orthologous group | 2DE1B |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.347 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Corynebacteriales
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 31/53 (58%) · mean identity 51.7%
· 4/4 closest MTBAP relatives conserved across the genus (present in 31/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 3/13 non-Mycobacterium reference genomes (down to Corynebacteriales) · mean identity 38.7% detected across the order Corynebacteriales (Corynebacterium/Nocardia/Rhodococcus/…) but not in more distant Actinomycetia — a Corynebacteriales-level gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 10 in the ORF — 0 in the essential state, 0 growth-defect, 10 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 206.9. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 7 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 94.8 ppm · rank 1329/3519 (62.3th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Predicted localisation (DeepTMHMM + lipobox) signal peptide
| Prediction | predicted secreted protein (signal peptide) |
|---|---|
| DeepTMHMM class | SP |
Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.
Physico-chemical properties (computed, ProtParam)
| Length | 143 aa |
|---|---|
| Molecular weight | 15.0 kDa |
| Theoretical pI | 9.46 |
| GRAVY | -0.003 (hydrophilic) |
| Aliphatic index | 86.2 |
| Aromaticity | 0.049 |
| Instability index | 45.2 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
DUF4189 | PF13827.12 | 2.2e-14 | 58–142 | Domain of unknown function (DUF4189) |
Experimental structures (Protein Data Bank) 1 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
7nhz |
Solution NMR | — | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (1 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural neighbours (Foldseek on the ESMFold model, exploratory)
ESMFold model confidence: mean pLDDT 91.7 (very high). A confident model makes the fold comparison meaningful.
Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.
| Target | Prob | TM | E-value | Description |
|---|---|---|---|---|
7nhz-assembly1_A |
1.00 | 0.67 | 7.1e-15 sig | 7nhz-assembly1_A NMR structure of Rv1813c from Mycobacterium tuberculosis |
2z3i-assembly1_D |
0.07 | 0.51 | 7.8e+00 | 2z3i-assembly1_D Crystal structure of blasticidin S deaminase (BSD) mutant E56Q complexed with substrate |
2z3j-assembly1_D |
0.05 | 0.35 | 6.1e+00 | 2z3j-assembly1_D Crystal structure of blasticidin S deaminase (BSD) R90K mutant |
5x8t-assembly1_S |
0.04 | 0.24 | 5.1e+00 | 5x8t-assembly1_S Structure of the 50S large subunit of chloroplast ribosome from spinach |
2z3g-assembly1_B |
0.04 | 0.35 | 7.8e+00 | 2z3g-assembly1_B Crystal structure of blasticidin S deaminase (BSD) |
4kq0-assembly1_D |
0.02 | 0.24 | 7.8e+00 | 4kq0-assembly1_D Crystal structure of double-helical CGG-repetitive RNA 19mer complexed with RSS p19 |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 82.1
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
7nhz-assembly1_A |
1.00 | 0.68 | 4.5e-15 sig | 7nhz-assembly1_A NMR structure of Rv1813c from Mycobacterium tuberculosis |
Foldseek search of the AlphaFold DB model (mean pLDDT 82.1, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | Rv1812c (- strand, 321 bp gap) |
|---|---|
| Downstream (3' on genome) | erg3 (+ strand, 408 bp gap) |
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2623 TB31.7 |
universal stress protein | 836 | 836 | coexpression:836 |
Rv2032 acg |
NAD(P)H nitroreductase | 901 | 834 | coexpression:833 textmining:433 |
Rv3134c |
universal stress protein | 859 | 829 | coexpression:829 |
Rv2627c hyp |
hypothetical protein | 828 | 828 | coexpression:827 |
Rv1733c |
transmembrane protein | 865 | 819 | coexpression:819 |
Rv2626c hrp1 |
hypoxic response protein | 851 | 813 | coexpression:813 |
Rv2031c hspX |
alpha-crystallin | 864 | 808 | coexpression:808 |
Rv1996 |
universal stress protein | 805 | 805 | coexpression:805 |
Rv2007c fdxA |
ferredoxin | 864 | 801 | coexpression:801 |
Rv3131 |
NAD(P)H nitroreductase | 844 | 801 | coexpression:800 |
Rv2030c hyp |
hypothetical protein | 904 | 800 | coexpression:800 textmining:541 |
Rv3127 hyp |
hypothetical protein | 897 | 800 | coexpression:799 textmining:510 |
Rv1737c narK2 |
nitrate/nitrite transporter | 833 | 798 | coexpression:793 |
Rv3130c tgs1 |
diacyglycerol O-acyltransferase | 818 | 767 | coexpression:767 |
Rv1738 hyp |
hypothetical protein | 828 | 738 | coexpression:738 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- MTBC0 PGAP product: DUF4189 domain-containing protein
- Pfam: DUF4189 PF13827.12
- Foldseek best: 7nhz-assembly1_A NMR structure of Rv1813c from Mycobacterium tuberculosis (prob 1.00, E=7e-15, TM=0.67)
- (structure-only promotion reviewed by hand, 2026-06-01)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216329.1)
- Domains: Pfam-A via hmmscan --cut_ga — DUF4189 (PF13827.12)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2DE1B - Curated reference: UniProt P9WLS1 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Model confidence: ESMFold per-residue pLDDT (mean 91.7, very high)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 82.1)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 31 functional partner(s)
- Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001925|Rv1813c| MITNLRRRTAMAAAGLGAALGLGILLVPTVDAHLANGSMSEVMMSEIAGLPIPPIIHYGAIAYAPSGASGKAWHQRTPARAEQVALEKCGDKTCKVVSRFTRCGAVAYNGSKYQGGTGLTRRAAEDDAVNRLEGGRIVNWACN
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for Rv1813c? Email the maintainer — the message is pre-filled with this gene's details.