Rv2016 Still unknown · low auto-curated

H37Rv Rv2016 · MTBC0 mtbc0_002146 · 191 aa · 2287039–2287614 (+) · RefSeq NP_216532.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Conserved hypothetical protein; no recognised domain. Function unknown. Foldseek best (non-significant) hit: 2e2l-assembly1_E Helicobacter pylori formamidase AmiF contains a fine- (prob 0.13, TM 0.52).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53462 TrEMBL · unreviewed · Evidence at protein level
UniProt nameUncharacterized protein

UniProt still lists this protein as Uncharacterized protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2BFQR

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.587 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 6 synonymous, 11 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 89.6 (confident). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
2e2l-assembly1_E 0.13 0.52 1.6e+00 2e2l-assembly1_E Helicobacter pylori formamidase AmiF contains a fine-tuned cysteine-glutamate-lysine catalytic triad
2e2k-assembly1_C 0.12 0.52 1.7e+00 2e2k-assembly1_C Helicobacter pylori formamidase AmiF contains a fine-tuned cysteine-glutamate-lysine catalytic triad
2vhh-assembly1_A-2 0.08 0.53 2.8e+00 2vhh-assembly1_A-2 Crystal structure of a pyrimidine degrading enzyme from Drosophila melanogaster
2dyu-assembly1_B 0.06 0.52 5.5e+00 2dyu-assembly1_B Helicobacter pylori formamidase AmiF contains a fine-tuned cysteine-glutamate-lysine catalytic triad
2e2k-assembly1_A 0.06 0.57 6.6e+00 2e2k-assembly1_A Helicobacter pylori formamidase AmiF contains a fine-tuned cysteine-glutamate-lysine catalytic triad
2e2l-assembly1_D 0.06 0.52 5.9e+00 2e2l-assembly1_D Helicobacter pylori formamidase AmiF contains a fine-tuned cysteine-glutamate-lysine catalytic triad
7t10-assembly1_R 0.05 0.43 7.5e+00 7t10-assembly1_R CryoEM structure of somatostatin receptor 2 in complex with somatostatin-14 and Gi3
2vhi-assembly1_A 0.05 0.53 5.9e+00 2vhi-assembly1_A Crystal structure of a pyrimidine degrading enzyme from Drosophila melanogaster

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2017 (transcriptional regulator), high confidence from genomic context alone (score 846 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2017 transcriptional regulator 927 846 ctx neighborhood:809 textmining:544
Rv2018 vapB45 hyp hypothetical protein 470 470 ctx neighborhood:443
Rv2019 vapC45 hyp hypothetical protein 577 430 ctx neighborhood:427
Rv2515c hyp hypothetical protein 476 102 textmining:441
Rv2165c rsmH rRNA small subunit methyltransferase H 444 55 textmining:436
Rv1765c hyp hypothetical protein 442 51 textmining:437
Rv3641c fic cell filamentation protein Fic 654 50 textmining:651
Rv0208c trmB tRNA (guanine-N(7)-)-methyltransferase 440 50 textmining:435
Rv2514c hyp hypothetical protein 624 47 textmining:622
Rv0078A hyp hypothetical protein 441 47 textmining:438
Rv0207c hyp hypothetical protein 436 47 textmining:433
Rv0229c vapC51 hyp hypothetical protein 651 46 textmining:650
Rv0268c hyp hypothetical protein 631 46 textmining:630
Rv3383c idsB polyprenyl synthetase IdsB 654 44 textmining:653
Rv1469 ctpD cobalt/nickel-exporting P-type ATPase 653 44 textmining:652

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: hypothetical protein
  • Foldseek best: 2e2l-assembly1_E Helicobacter pylori formamidase AmiF contains a fine-tuned cyst (prob 0.13, E=2e+00, TM=0.52)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216532.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2BFQR
  • Curated reference: UniProt O53462 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 89.6, confident)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 25 functional partner(s); context anchor Rv2017
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002146|Rv2016|
MTELGDKFLAALVGTIRDTRFDIADMRNWRPGWFPTMHSRCLSNLIHDRIWAHLVTLIASNPGTSIKDKGATREIVVGAHLRLRIKRHHAGDEISTYPTRTAIEFWQQGSQPAFPGLEEVRIAVGYRWDPDTREIGAPLLSLRDGKDHVIWVVELDEPAAGVKITWTPIEPTLPSIDFGDLGEDSGASGER