Rv2375 Family assigned · medium auto-curated
H37Rv Rv2375 · MTBC0 mtbc0_002527 ·
105 aa · 2679458–2679775 (+) ·
RefSeq NP_216891.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | type II toxin-antitoxin system VapB family antitoxin |
| Revised (this work) | Type II toxin-antitoxin system VapB family antitoxin. Pfam: VapB (PF23719.2). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O05823
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Type II toxin-antitoxin system VapB family antitoxin |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
K Transcription
|
|---|---|
| eggNOG description | Transcription regulator of the Arc MetJ class |
| Orthologous group | COG5450 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
VapB | PF23719.2 | 5.7e-49 | 1–96 | Antitoxin VapB-like |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: hrcA (heat-inducible transcription repressor HrcA), high confidence from genomic context alone (score 766 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2374c hrcA |
heat-inducible transcription repressor HrcA | 766 | 766 ctx | neighborhood:766 |
Rv3586 disA |
DNA integrity scanning protein DisA | 717 | 718 ctx | cooccurence:717 |
Rv2373c dnaJ2 |
chaperone protein DnaJ | 663 | 663 ctx | neighborhood:662 |
Rv2372c rsmE |
rRNA small subunit methyltransferase E | 539 | 539 ctx | neighborhood:535 |
Rv1929c hyp |
hypothetical protein | 499 | 499 ctx | cooccurence:499 |
Rv2466c hyp |
hypothetical protein | 459 | 459 ctx | cooccurence:459 |
Rv1823 hyp |
hypothetical protein | 448 | 448 ctx | cooccurence:447 |
Rv1824 hyp |
hypothetical protein | 436 | 436 ctx | cooccurence:434 |
Rv0012 |
membrane protein | 423 | 424 ctx | cooccurence:420 |
Rv0430 hyp |
hypothetical protein | 411 | 411 ctx | cooccurence:408 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: type II toxin-antitoxin system VapB family antitoxin
- Pfam (hmmscan --cut_ga): VapB PF23719.2 (E=6e-49)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216891.1)
- Domains: Pfam-A via hmmscan --cut_ga — VapB (PF23719.2)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG5450 - Curated reference: UniProt O05823 (TrEMBL, unreviewed; Evidence at protein level)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
10 functional partner(s); context anchor
hrcA - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002527|Rv2375| MIFKGVREGKPYPEHGLSYRDWSQIPPQQIRLDELVTTTTVLALDRLLSEDSTFYGDLFPHAVKWRGTTYLEDGLHRAVRAALRNRTVLHARVFDMDASPGGRRS