Rv2375 Family assigned · medium auto-curated

H37Rv Rv2375 · MTBC0 mtbc0_002527 · 105 aa · 2679458–2679775 (+) · RefSeq NP_216891.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationtype II toxin-antitoxin system VapB family antitoxin
Revised (this work)Type II toxin-antitoxin system VapB family antitoxin. Pfam: VapB (PF23719.2).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O05823 TrEMBL · unreviewed · Evidence at protein level
UniProt nameType II toxin-antitoxin system VapB family antitoxin

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
eggNOG descriptionTranscription regulator of the Arc MetJ class
Orthologous groupCOG5450

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
VapBPF23719.2 5.7e-491–96 Antitoxin VapB-like

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: hrcA (heat-inducible transcription repressor HrcA), high confidence from genomic context alone (score 766 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2374c hrcA heat-inducible transcription repressor HrcA 766 766 ctx neighborhood:766
Rv3586 disA DNA integrity scanning protein DisA 717 718 ctx cooccurence:717
Rv2373c dnaJ2 chaperone protein DnaJ 663 663 ctx neighborhood:662
Rv2372c rsmE rRNA small subunit methyltransferase E 539 539 ctx neighborhood:535
Rv1929c hyp hypothetical protein 499 499 ctx cooccurence:499
Rv2466c hyp hypothetical protein 459 459 ctx cooccurence:459
Rv1823 hyp hypothetical protein 448 448 ctx cooccurence:447
Rv1824 hyp hypothetical protein 436 436 ctx cooccurence:434
Rv0012 membrane protein 423 424 ctx cooccurence:420
Rv0430 hyp hypothetical protein 411 411 ctx cooccurence:408

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: type II toxin-antitoxin system VapB family antitoxin
  • Pfam (hmmscan --cut_ga): VapB PF23719.2 (E=6e-49)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216891.1)
  • Domains: Pfam-A via hmmscan --cut_ga — VapB (PF23719.2)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG5450
  • Curated reference: UniProt O05823 (TrEMBL, unreviewed; Evidence at protein level)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 10 functional partner(s); context anchor hrcA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002527|Rv2375|
MIFKGVREGKPYPEHGLSYRDWSQIPPQQIRLDELVTTTTVLALDRLLSEDSTFYGDLFPHAVKWRGTTYLEDGLHRAVRAALRNRTVLHARVFDMDASPGGRRS