Rv1465 Family assigned · medium auto-curated

H37Rv Rv1465 · MTBC0 mtbc0_001567 · 162 aa · 1662573–1663061 (+) · RefSeq NP_215981.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)nitrogen fixation related protein
MTBC0 PGAP re-annotationSUF system NifU family Fe-S cluster assembly protein
Revised (this work)SUF system NifU family Fe-S cluster assembly protein. Pfam: NifU_N (PF01592.22).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53156 TrEMBL · unreviewed · Evidence at protein level
UniProt namePossible nitrogen fixation related protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
Preferred nameiscU
eggNOG descriptionSUF system FeS assembly protein
Orthologous groupCOG0822
KEGG orthology K04488

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.164 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
NifU_NPF01592.22 3.9e-389–131 NifU-like N terminal domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: csd (cysteine desulfurase), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1464 csd cysteine desulfurase 999 1000 ctx neighborhood:881 cooccurence:767 coexpression:955 experimental:785 textmining:824
Rv1463 sufC ABC transporter ATP-binding protein 999 999 ctx neighborhood:881 cooccurence:748 coexpression:966 textmining:872
Rv1462 sufD hyp hypothetical protein 999 998 ctx neighborhood:881 cooccurence:706 coexpression:939 textmining:885
Rv3025c iscS cysteine desulfurase 998 998 coexpression:857 experimental:928 database:844
Rv1466 hyp hypothetical protein 996 997 ctx neighborhood:882 cooccurence:574 coexpression:944
Rv1461 sufB hyp hypothetical protein 987 986 ctx neighborhood:791 cooccurence:751 coexpression:755
Rv3778c aminotransferase 972 969 ctx cooccurence:544 coexpression:692 experimental:785
Rv3700c egtE pyridoxal-phosphate-dependent protein EgtE 968 952 coexpression:692 experimental:785
Rv1460 sufR transcriptional regulator 919 894 ctx neighborhood:881
Rv1937 oxygenase 870 856 experimental:414 database:621
Rv2776c oxidoreductase 872 853 database:621
Rv3554 fdxB electron transfer protein FdxB 885 851 database:621
Rv3230c stearoyl-CoA 9-desaturase electron transfer protein 869 850 database:621
Rv3571 kshB 3-ketosteroid-9-alpha-hydroxylase reductase subunit 868 849 database:621
Rv2204c hyp hypothetical protein 859 817 coexpression:802

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: nitrogen fixation related protein
  • MTBC0 PGAP product: SUF system NifU family Fe-S cluster assembly protein
  • Pfam (hmmscan --cut_ga): NifU_N PF01592.22 (E=4e-38)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215981.1)
  • Domains: Pfam-A via hmmscan --cut_ga — NifU_N (PF01592.22)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0822
  • Curated reference: UniProt O53156 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 28 functional partner(s); context anchor csd
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001567|Rv1465|
MTLRLEQIYQDVILDHYKHPQHRGLREPFGAQVYHVNPICGDEVTLRVALSEDGTRVTDVSYDGQGCSISQAATSVLTEQVIGQRVPRALNIVDAFTEMVSSRGTVPGDEDVLGDGVAFAGVAKYPARVKCALLGWMAFKDALAQASEAFEEVTDERNQRTG