ptpA Resolved · high auto-curated
H37Rv Rv2234 · MTBC0 mtbc0_002374 ·
163 aa ·
2533304–2533795 MTBC0
(+) ·
RefSeq NP_216750.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | protein-tyrosine-phosphatase |
|---|---|
| MTBC0 PGAP re-annotation | protein-tyrosine-phosphatase |
| Revised (this work) | Protein-tyrosine-phosphatase. Pfam: LMWPc (PF01451.28). |
| Functional category (TubercuList) | regulatory proteins |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 58 publications
58 TB publications mention this gene. 58 publication(s) discuss this gene (46 in a M. tuberculosis context, 5 in other mycobacteria — M. smegmatis (3), M. abscessus (1), M. marinum (1)).
| Publication | Date |
|---|---|
| Diagnostic value of antibody responses to Mycobacterium avium subsp. paratuberculosis-derived proteins PtpA and PtpB in rheumatoid arthritis. doi:10.1371/journal.pone.0341403 | 2026 |
| Molecular Insights into Anabaenopeptin-Mediated Inhibition of Protein Tyrosine Phosphatase B in the Mycobacterium tuberculosis Complex. doi:10.1021/acsomega.5c01567 | 2026 |
| Research progress on protein tyrosine phosphatase A from Mycobacterium tuberculosis. doi:10.3389/fimmu.2025.1754992 | 2025 |
| Vacuolar-ATPase inhibitors are antimicrobial agents active against intracellular mycobacteria. doi:10.1128/aac.00478-25 | 2025 |
| Mycobacterial Tyrosine Phosphatase PtpB Affects Host Cytokine Expression by Dephosphorylating ERK1/2 and STAT3. doi:10.1016/j.mcpro.2025.101067 | 2025 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 2 % of gene
| Neighbour | nt5e (Rv2232, + strand) |
|---|---|
| Overlap | 8 bp, 2 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
Post-translational modifications
4 reported modified residue(s), incl. 3 phosphosite(s):
Phosphothreonine; by PknA @45, S-nitrosocysteine @53, Phosphotyrosine @128, Phosphotyrosine @129.
Experimentally reported post-translational modification(s). A phosphosite indicates the protein is expressed and is a substrate of the M. tuberculosis Ser/Thr/Tyr kinase signalling network — a regulatory context, NOT a molecular function. Source: UniProt (Modified residue features; PTM sites curated from the M. tuberculosis literature).
CRISPRi vulnerability
Vulnerability index -3.50 (95% CI -5.26 to -0.94). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in signal transduction (via dephosphorylation). Can dephosphorylated in vitro the phosphotyrosine residue of myelin basic protein (MBP) at pH 7.0 [catalytic activity: protein tyrosine phosphate + H(2)O = protein tyrosine + phosphate]. |
|---|---|
| Mycobrowser EC |
3.1.3.48
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2258
· 99.4% identity |
|---|---|
| M. marinum |
MMAR_3309
· 80.2% identity |
| M. smegmatis |
MSMEG_4309
· 72.0% identity |
| M. orygis |
RJtmp_002309
· 99.4% identity |
| M. abscessus |
MAB_1900c
· 68.8% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WIA1
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Low molecular weight protein-tyrosine phosphatase A |
| EC (curated) |
EC 3.1.3.48
|
| Curated function | Key virulence factor required for mycobacterial survival within host macrophages. Exhibits protein tyrosine phosphatase activity. Shows no detectable activity towards substrates containing phosphoserine/threonine residues..; FUNCTION: Supports mycobacteria survival during infection by modulation of the phagosome maturation and modulation of the normal host signaling pathways, including host innate immune responses and cell apoptosis. Affects the phagocytosis process by preventing phagosome acidification and maturation in the macrophage. This inhibition depends on both PtpA phosphatase activity. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
T Signal transduction mechanisms
|
|---|---|
| Preferred name | ptpA |
| eggNOG description | Low molecular weight phosphotyrosine protein phosphatase |
| Orthologous group | COG0394 |
| EC number |
EC 3.1.3.48
|
| KEGG orthology |
K01104
|
| Gene Ontology (69) |
GO:0003674, GO:0003824, GO:0004721, GO:0004725, GO:0005575, GO:0005576, GO:0005623, GO:0005886, GO:0006464, GO:0006470, GO:0006793, GO:0006796 +57 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.344 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.346 (low power)
· 2 consensus substitution(s) low power (2 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 79.1%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 12/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 50.0% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 7 in the ORF — 0 in the essential state, 0 growth-defect, 7 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 64.1428571429. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Read with some caution: only 7 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 7 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB)
| Condition | log2FC | q | Effect |
|---|---|---|---|
| fitness after prolonged in vitro passage (in vitro passage) | -2.81 | 0.012 | required |
Conditional fitness of transposon-disruption mutants across 1 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 10 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 21.9 ppm · rank 2284/3519 (35.1th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 163 aa |
|---|---|
| Molecular weight | 17.9 kDa |
| Theoretical pI | 6.03 |
| GRAVY | -0.33 (hydrophilic) |
| Aliphatic index | 80.2 |
| Aromaticity | 0.061 |
| Instability index | 42.5 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
LMWPc | PF01451.28 | 1.4e-54 | 6–155 | Low molecular weight phosphotyrosine protein phosphatase |
Experimental structures (Protein Data Bank) 3 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
1u2p |
X-ray diffraction | 1.9 Å | 100% |
1u2q |
X-ray diffraction | 2.5 Å | 100% |
2luo |
Solution NMR | — | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (3 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 94.6
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
1u2p-assembly1_A |
1.00 | 0.98 | 4.9e-31 sig | 1u2p-assembly1_A Crystal structure of Mycobacterium tuberculosis Low Molecular Protein Tyrosine Phosphatase (MPtpA) at 1.9A resolution |
1c0e-assembly2_B |
1.00 | 0.89 | 2.0e-15 sig | 1c0e-assembly2_B Active Site S19A Mutant of Bovine Heart Phosphotyrosyl Phosphatase |
3js5-assembly1_A |
1.00 | 0.91 | 8.5e-15 sig | 3js5-assembly1_A Crystal structure of protein tyrosine phosphatase from Entamoeba histolytica with Hepes in the active site. High resolution, alternative crystal form with 1 molecule in asymmetric unit |
5jnu-assembly1_B |
1.00 | 0.87 | 2.8e-15 sig | 5jnu-assembly1_B Crystal structure of mouse Low-Molecular Weight Protein Tyrosine Phosphatase type A (LMPTP-A) complexed with phosphate |
7kh8-assembly2_B |
1.00 | 0.91 | 1.7e-14 sig | 7kh8-assembly2_B Human LMPTP in complex with inhibitor |
Foldseek search of the AlphaFold DB model (mean pLDDT 94.6, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 3
| Upstream (5' on genome) | ptkA (+ strand, -8 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv2235 (+ strand, -1 bp gap) |
| Predicted operon |
ptkA · ptpA · Rv2235
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (1 TF) |
Rv1353c (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: Rv2235 (transmembrane protein), high confidence from genomic context alone (score 887 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0153c ptbB exp |
phosphotyrosine protein phosphatase | 987 | 901 | database:900 textmining:881 |
Rv2235 |
transmembrane protein | 887 | 887 ctx | neighborhood:882 |
Rv2232 ptkA |
protein tyrosine kinase transcriptional regulator PtkA | 959 | 884 ctx | neighborhood:882 textmining:660 |
Rv2230c |
GTP cyclohydrolase | 766 | 758 ctx | neighborhood:746 |
Rv2228c |
multifunctional RNASE H/alpha-ribazole phosphatase/acid phosphatase | 815 | 755 ctx | neighborhood:746 |
Rv2229c hyp |
hypothetical protein | 754 | 754 ctx | neighborhood:746 |
Rv2231c cobC |
aminotransferase | 748 | 748 ctx | neighborhood:746 |
Rv2231A vapC16 |
ribonuclease VapC16 | 539 | 539 ctx | neighborhood:539 |
Rv2940c mas |
multifunctional mycocerosic acid synthase | 558 | 510 | |
Rv1527c pks5 |
polyketide synthase | 557 | 509 | |
Rv2048c pks12 |
polyketide synthase | 557 | 509 | |
Rv3825c pks2 |
phthioceranic/hydroxyphthioceranic acid synthase | 556 | 508 | |
Rv2933 ppsC |
phthiocerol synthesis polyketide synthase type I PpsC | 555 | 506 | |
Rv3206c moeB1 |
adenylyltransferase/sulfurtransferase MoeZ | 503 | 485 | |
Rv3116 moeB2 |
molybdenum cofactor biosynthesis protein MoeB | 501 | 483 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: protein-tyrosine-phosphatase
- MTBC0 PGAP product: protein-tyrosine-phosphatase
- Pfam (hmmscan --cut_ga): LMWPc PF01451.28 (E=1e-54)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216750.1)
- Domains: Pfam-A via hmmscan --cut_ga — LMWPc (PF01451.28)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0394 - Curated reference: UniProt P9WIA1 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 94.6)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
56 functional partner(s); context anchor
Rv2235 - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002374|Rv2234|ptpA MSDPLHVTFVCTGNICRSPMAEKMFAQQLRHRGLGDAVRVTSAGTGNWHVGSCADERAAGVLRAHGYPTDHRAAQVGTEHLAADLLVALDRNHARLLRQLGVEAARVRMLRSFDPRSGTHALDVEDPYYGDHSDFEEVFAVIESALPGLHDWVDERLARNGPS
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for ptpA? Email the maintainer — the message is pre-filled with this gene's details.