ptpA Resolved · high auto-curated

H37Rv Rv2234 · MTBC0 mtbc0_002374 · 163 aa · 2533304–2533795 (+) · RefSeq NP_216750.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)protein-tyrosine-phosphatase
MTBC0 PGAP re-annotationprotein-tyrosine-phosphatase
Revised (this work)Protein-tyrosine-phosphatase. Pfam: LMWPc (PF01451.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WIA1 SwissProt · reviewed · Evidence at protein level
UniProt nameLow molecular weight protein-tyrosine phosphatase A
EC (curated) EC 3.1.3.48
Curated functionKey virulence factor required for mycobacterial survival within host macrophages. Exhibits protein tyrosine phosphatase activity. Shows no detectable activity towards substrates containing phosphoserine/threonine residues..; FUNCTION: Supports mycobacteria survival during infection by modulation of the phagosome maturation and modulation of the normal host signaling pathways, including host innate immune responses and cell apoptosis. Affects the phagocytosis process by preventing phagosome acidification and maturation in the macrophage. This inhibition depends on both PtpA phosphatase activity.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category T Signal transduction mechanisms
Preferred nameptpA
eggNOG descriptionLow molecular weight phosphotyrosine protein phosphatase
Orthologous groupCOG0394
EC number EC 3.1.3.48
KEGG orthology K01104
Gene Ontology (69) GO:0003674, GO:0003824, GO:0004721, GO:0004725, GO:0005575, GO:0005576, GO:0005623, GO:0005886, GO:0006464, GO:0006470, GO:0006793, GO:0006796 +57 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.344 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
LMWPcPF01451.28 1.4e-546–155 Low molecular weight phosphotyrosine protein phosphatase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv2235 (transmembrane protein), high confidence from genomic context alone (score 887 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0153c ptbB phosphotyrosine protein phosphatase 987 901 database:900 textmining:881
Rv2235 transmembrane protein 887 887 ctx neighborhood:882
Rv2232 ptkA protein tyrosine kinase transcriptional regulator PtkA 959 884 ctx neighborhood:882 textmining:660
Rv2230c GTP cyclohydrolase 766 758 ctx neighborhood:746
Rv2228c multifunctional RNASE H/alpha-ribazole phosphatase/acid phosphatase 815 755 ctx neighborhood:746
Rv2229c hyp hypothetical protein 754 754 ctx neighborhood:746
Rv2231c cobC aminotransferase 748 748 ctx neighborhood:746
Rv2231A vapC16 ribonuclease VapC16 539 539 ctx neighborhood:539
Rv2940c mas multifunctional mycocerosic acid synthase 558 510
Rv1527c pks5 polyketide synthase 557 509
Rv2048c pks12 polyketide synthase 557 509
Rv3825c pks2 phthioceranic/hydroxyphthioceranic acid synthase 556 508
Rv2933 ppsC phthiocerol synthesis polyketide synthase type I PpsC 555 506
Rv3206c moeB1 adenylyltransferase/sulfurtransferase MoeZ 503 485
Rv3116 moeB2 molybdenum cofactor biosynthesis protein MoeB 501 483

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: protein-tyrosine-phosphatase
  • MTBC0 PGAP product: protein-tyrosine-phosphatase
  • Pfam (hmmscan --cut_ga): LMWPc PF01451.28 (E=1e-54)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216750.1)
  • Domains: Pfam-A via hmmscan --cut_ga — LMWPc (PF01451.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0394
  • Curated reference: UniProt P9WIA1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 56 functional partner(s); context anchor Rv2235
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002374|Rv2234|ptpA
MSDPLHVTFVCTGNICRSPMAEKMFAQQLRHRGLGDAVRVTSAGTGNWHVGSCADERAAGVLRAHGYPTDHRAAQVGTEHLAADLLVALDRNHARLLRQLGVEAARVRMLRSFDPRSGTHALDVEDPYYGDHSDFEEVFAVIESALPGLHDWVDERLARNGPS