Rv1466 Resolved · high auto-curated

H37Rv Rv1466 · MTBC0 mtbc0_001568 · 115 aa · 1663036–1663383 (+) · RefSeq NP_215982.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationmetal-sulfur cluster assembly factor
Revised (this work)Metal-sulfur cluster assembly factor. Pfam: FeS_assembly_P (PF01883.25).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53157 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred nameyitW
eggNOG descriptionmetal-sulfur cluster biosynthetic enzyme
Orthologous groupCOG2151

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.158 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
FeS_assembly_PPF01883.25 1.2e-1713–79 Iron-sulfur cluster assembly protein

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1465 (nitrogen fixation related protein), high confidence from genomic context alone (score 997 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1465 nitrogen fixation related protein 996 997 ctx neighborhood:882 cooccurence:574 coexpression:944
Rv1464 csd cysteine desulfurase 988 987 ctx neighborhood:881 cooccurence:635 coexpression:731
Rv1463 sufC ABC transporter ATP-binding protein 982 980 ctx neighborhood:881 cooccurence:741 coexpression:415
Rv1462 sufD hyp hypothetical protein 972 969 ctx neighborhood:881 cooccurence:723
Rv1461 sufB hyp hypothetical protein 951 946 ctx neighborhood:797 cooccurence:724
Rv1460 sufR transcriptional regulator 881 882 ctx neighborhood:881
Rv1459c mptB alpha-(1->6)-mannopyranosyltransferase 727 728 ctx neighborhood:726
Rv1457c antibiotic ABC transporter permease 713 714 ctx neighborhood:712
Rv1458c antibiotic ABC transporter ATP-binding protein 712 712 ctx neighborhood:712
Rv1456c antibiotic ABC transporter permease 586 586 ctx neighborhood:585
Rv0885 hyp hypothetical protein 598 477 coexpression:434
Rv2776c oxidoreductase 606 476 coexpression:403
Rv3554 fdxB electron transfer protein FdxB 598 465
Rv3230c stearoyl-CoA 9-desaturase electron transfer protein 597 464
Rv3571 kshB 3-ketosteroid-9-alpha-hydroxylase reductase subunit 597 463

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: metal-sulfur cluster assembly factor
  • Pfam (hmmscan --cut_ga): FeS_assembly_P PF01883.25 (E=1e-17)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215982.1)
  • Domains: Pfam-A via hmmscan --cut_ga — FeS_assembly_P (PF01883.25)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2151
  • Curated reference: UniProt O53157 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 30 functional partner(s); context anchor Rv1465
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001568|Rv1466|
MSETSAPAEELLADVEEAMRDVVDPELGINVVDLGLVYGLDVQDGDEGTVALIDMTLTSAACPLTDVIEDQSRSALVGSGLVDDIRINWVWNPPWGPDKITEDGREQLRALGFTV