Rv1466 Resolved · high auto-curated
H37Rv Rv1466 · MTBC0 mtbc0_001568 ·
115 aa · 1663036–1663383 (+) ·
RefSeq NP_215982.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | metal-sulfur cluster assembly factor |
| Revised (this work) | Metal-sulfur cluster assembly factor. Pfam: FeS_assembly_P (PF01883.25). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O53157
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Conserved protein |
UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| Preferred name | yitW |
| eggNOG description | metal-sulfur cluster biosynthetic enzyme |
| Orthologous group | COG2151 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.158 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
FeS_assembly_P | PF01883.25 | 1.2e-17 | 13–79 | Iron-sulfur cluster assembly protein |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv1465 (nitrogen fixation related protein), high confidence from genomic context alone (score 997 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1465 |
nitrogen fixation related protein | 996 | 997 ctx | neighborhood:882 cooccurence:574 coexpression:944 |
Rv1464 csd |
cysteine desulfurase | 988 | 987 ctx | neighborhood:881 cooccurence:635 coexpression:731 |
Rv1463 sufC |
ABC transporter ATP-binding protein | 982 | 980 ctx | neighborhood:881 cooccurence:741 coexpression:415 |
Rv1462 sufD hyp |
hypothetical protein | 972 | 969 ctx | neighborhood:881 cooccurence:723 |
Rv1461 sufB hyp |
hypothetical protein | 951 | 946 ctx | neighborhood:797 cooccurence:724 |
Rv1460 sufR |
transcriptional regulator | 881 | 882 ctx | neighborhood:881 |
Rv1459c mptB |
alpha-(1->6)-mannopyranosyltransferase | 727 | 728 ctx | neighborhood:726 |
Rv1457c |
antibiotic ABC transporter permease | 713 | 714 ctx | neighborhood:712 |
Rv1458c |
antibiotic ABC transporter ATP-binding protein | 712 | 712 ctx | neighborhood:712 |
Rv1456c |
antibiotic ABC transporter permease | 586 | 586 ctx | neighborhood:585 |
Rv0885 hyp |
hypothetical protein | 598 | 477 | coexpression:434 |
Rv2776c |
oxidoreductase | 606 | 476 | coexpression:403 |
Rv3554 fdxB |
electron transfer protein FdxB | 598 | 465 | |
Rv3230c |
stearoyl-CoA 9-desaturase electron transfer protein | 597 | 464 | |
Rv3571 kshB |
3-ketosteroid-9-alpha-hydroxylase reductase subunit | 597 | 463 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: metal-sulfur cluster assembly factor
- Pfam (hmmscan --cut_ga): FeS_assembly_P PF01883.25 (E=1e-17)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215982.1)
- Domains: Pfam-A via hmmscan --cut_ga — FeS_assembly_P (PF01883.25)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2151 - Curated reference: UniProt O53157 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
30 functional partner(s); context anchor
Rv1465 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001568|Rv1466| MSETSAPAEELLADVEEAMRDVVDPELGINVVDLGLVYGLDVQDGDEGTVALIDMTLTSAACPLTDVIEDQSRSALVGSGLVDDIRINWVWNPPWGPDKITEDGREQLRALGFTV