mbtJ Resolved · high auto-curated
H37Rv Rv2385 · MTBC0 - ·
306 aa ·
2677729–2678649 H37Rv
(+) ·
RefSeq YP_177876.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | acetyl hydrolase |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Acetyl hydrolase. Pfam: BD-FAE (PF20434.6), Abhydrolase_3 (PF07859.20). |
| Functional category (TubercuList) | lipid metabolism |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
In the literature (TB corpus sweep) 3 publications
3 TB publications mention this gene. 3 publication(s) discuss this gene (3 in a M. tuberculosis context, 1 in other mycobacteria — M. smegmatis (1)).
| Publication | Date |
|---|---|
| mbtJ: an iron stress-induced acetyl hydrolase/esterase of Mycobacterium tuberculosis helps bacteria to survive during iron stress. doi:10.2217/fmb-2017-0194 | 2018 |
| Comparative genomics between human and animal associated subspecies of the Mycobacterium avium complex: a basis for pathogenicity. doi:10.1186/s12864-015-1889-2 | 2015 |
| Alternative activation deprives macrophages of a coordinated defense program to Mycobacterium tuberculosis. doi:10.1002/eji.200535496 | 2006 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Conditional expression context (iModulons)
Member of 1 independently-modulated gene set(s):
IdeR (ideR).
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
CRISPRi vulnerability
Vulnerability index 1.41 (95% CI -0.25 to 4.10). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in the biogenesis of the hydroxyphenyloxazoline-containing siderophore mycobactins. Possibly required for N-hydroxylation of the two lysine residues at some stage during mycobactin assembly. |
|---|---|
| Mycobrowser EC |
3.1.1.-
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2406
· 100.0% identity |
|---|---|
| M. marinum |
MMAR_3699
· 75.1% identity |
| M. orygis |
RJtmp_002463
· 100.0% identity |
| M. abscessus |
MAB_4052c
· 49.5% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
Q79FE8
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Acetyl hydrolase MbtJ |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
I Lipid transport and metabolism
|
|---|---|
| Preferred name | mbtJ |
| eggNOG description | hydrolase |
| Orthologous group | COG0657 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.365 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Actinomycetia
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 49/53 (92%) · mean identity 62.5%
· 3/4 closest MTBAP relatives conserved across the genus (present in 49/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 7/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 38.9% detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 19 in the ORF — 0 in the essential state, 0 growth-defect, 19 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 100.263157895. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 11 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 16.7 ppm · rank 2438/3519 (30.7th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 306 aa |
|---|---|
| Molecular weight | 32.9 kDa |
| Theoretical pI | 7.83 |
| GRAVY | 0.065 (hydrophobic) |
| Aliphatic index | 93.2 |
| Aromaticity | 0.075 |
| Instability index | 35.3 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
BD-FAE | PF20434.6 | 7.0e-09 | 75–157 | BD-FAE |
Abhydrolase_3 | PF07859.20 | 4.2e-38 | 77–277 | alpha/beta hydrolase fold |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 91.6
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
7at3-assembly2_B |
1.00 | 0.87 | 1.2e-24 sig | 7at3-assembly2_B Structure of EstD11 in complex with Naproxen and methanol |
7atd-assembly2_B |
1.00 | 0.87 | 2.6e-24 sig | 7atd-assembly2_B Structure of inactive EstD11 S144A in complex with methyl-naproxen |
7av5-assembly1_AAA |
1.00 | 0.87 | 5.0e-24 sig | 7av5-assembly1_AAA Structure of EstD11 in complex with Fluorescein |
4xvc-assembly4_D |
1.00 | 0.87 | 8.4e-24 sig | 4xvc-assembly4_D Crystal structure of an esterase from the bacterial hormone-sensitive lipase (HSL) family |
7at4-assembly1_A |
1.00 | 0.85 | 1.1e-23 sig | 7at4-assembly1_A Structure of EstD11 in complex with Naproxen |
Foldseek search of the AlphaFold DB model (mean pLDDT 91.6, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | mbtA (+ strand, 95 bp gap) |
|---|---|
| Downstream (3' on genome) | mbtI (- strand, 3 bp gap) |
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: mbtA (2,3-dihydroxybenzoate-AMP ligase), high confidence from genomic context alone (score 912 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2384 mbtA |
2,3-dihydroxybenzoate-AMP ligase | 990 | 912 ctx | neighborhood:582 coexpression:798 textmining:898 |
Rv3402c hyp |
hypothetical protein | 785 | 785 | coexpression:785 |
Rv1400c lipI |
lipase | 773 | 773 ctx | cooccurence:773 |
Rv3097c lipY |
triacylglycerol lipase Lip | 760 | 760 ctx | cooccurence:760 |
Rv2386c mbtI |
salicylate synthase | 965 | 718 | coexpression:687 textmining:884 |
Rv2383c mbtB |
phenyloxazoline synthase | 915 | 666 ctx | neighborhood:409 coexpression:458 textmining:757 |
Rv2382c mbtC |
polyketide synthetase | 823 | 584 ctx | neighborhood:406 textmining:593 |
Rv2381c mbtD |
polyketide synthetase | 841 | 556 | textmining:657 |
Rv2380c mbtE |
peptide synthetase | 843 | 548 | textmining:668 |
Rv0722 rpmD exp |
50S ribosomal protein L30 | 491 | 492 | database:490 |
Rv2903c lepB exp |
signal peptidase | 499 | 480 | database:464 |
Rv0310c hyp exp |
hypothetical protein | 477 | 474 | experimental:439 |
Rv3153 nuoI exp |
NADH-quinone oxidoreductase subunit I | 451 | 452 | experimental:440 |
Rv3151 nuoG exp |
NADH-quinone oxidoreductase subunit G | 471 | 447 | experimental:441 |
Rv3150 nuoF exp |
NADH-quinone oxidoreductase subunit F | 443 | 443 | experimental:441 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): acetyl hydrolase
- Pfam (hmmscan --cut_ga): BD-FAE PF20434.6 (E=7e-09), Abhydrolase_3 PF07859.20 (E=4e-38)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177876.1)
- Domains: Pfam-A via hmmscan --cut_ga — BD-FAE (PF20434.6), Abhydrolase_3 (PF07859.20)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0657 - Curated reference: UniProt Q79FE8 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 91.6)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
43 functional partner(s); context anchor
mbtA - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv2385|mbtJ MVLRPITGAIPPDGPWGIWASRRIIAGLMGTFGPSLAGTRVEQVNSVLPDGRRVVGEWVYGPHNNAINAGPGGGAIYYVHGSGYTMCSPRTHRRLTSWLSSLTGLPVFSVDYRLAPRYRFPTAATDVRAAWDWLAHVCGLAAEHMVIAADSAGGHLTVDMLLQPEVAARPPAAVVLFSPLIDLTFRLGASRELQRPDPVVRADRAARSVALYYTGVDPAHHRLALDVAGGPPLPPTLIQVGGAEILEADARQLDADIRAAGGICELQVWPDQMHVFQALPRMTPEAAKAMTYVAQFIRSTTARGDL
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for mbtJ? Email the maintainer — the message is pre-filled with this gene's details.