mbtJ Resolved · high auto-curated
H37Rv Rv2385 · MTBC0 - ·
306 aa · 2677729–2678649 (+) ·
RefSeq YP_177876.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | acetyl hydrolase |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Acetyl hydrolase. Pfam: BD-FAE (PF20434.6), Abhydrolase_3 (PF07859.20). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
Q79FE8
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Acetyl hydrolase MbtJ |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
I Lipid transport and metabolism
|
|---|---|
| Preferred name | mbtJ |
| eggNOG description | hydrolase |
| Orthologous group | COG0657 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.365 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
BD-FAE | PF20434.6 | 7.0e-09 | 75–157 | BD-FAE |
Abhydrolase_3 | PF07859.20 | 4.2e-38 | 77–277 | alpha/beta hydrolase fold |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: mbtA (2,3-dihydroxybenzoate-AMP ligase), high confidence from genomic context alone (score 912 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2384 mbtA |
2,3-dihydroxybenzoate-AMP ligase | 990 | 912 ctx | neighborhood:582 coexpression:798 textmining:898 |
Rv3402c hyp |
hypothetical protein | 785 | 785 | coexpression:785 |
Rv1400c lipI |
lipase | 773 | 773 ctx | cooccurence:773 |
Rv3097c lipY |
triacylglycerol lipase Lip | 760 | 760 ctx | cooccurence:760 |
Rv2386c mbtI |
salicylate synthase | 965 | 718 | coexpression:687 textmining:884 |
Rv2383c mbtB |
phenyloxazoline synthase | 915 | 666 ctx | neighborhood:409 coexpression:458 textmining:757 |
Rv2382c mbtC |
polyketide synthetase | 823 | 584 ctx | neighborhood:406 textmining:593 |
Rv2381c mbtD |
polyketide synthetase | 841 | 556 | textmining:657 |
Rv2380c mbtE |
peptide synthetase | 843 | 548 | textmining:668 |
Rv0722 rpmD |
50S ribosomal protein L30 | 491 | 492 | database:490 |
Rv2903c lepB |
signal peptidase | 499 | 480 | database:464 |
Rv0310c hyp |
hypothetical protein | 477 | 474 | experimental:439 |
Rv3153 nuoI |
NADH-quinone oxidoreductase subunit I | 451 | 452 | experimental:440 |
Rv3151 nuoG |
NADH-quinone oxidoreductase subunit G | 471 | 447 | experimental:441 |
Rv3150 nuoF |
NADH-quinone oxidoreductase subunit F | 443 | 443 | experimental:441 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): acetyl hydrolase
- Pfam (hmmscan --cut_ga): BD-FAE PF20434.6 (E=7e-09), Abhydrolase_3 PF07859.20 (E=4e-38)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177876.1)
- Domains: Pfam-A via hmmscan --cut_ga — BD-FAE (PF20434.6), Abhydrolase_3 (PF07859.20)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0657 - Curated reference: UniProt Q79FE8 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
43 functional partner(s); context anchor
mbtA - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv2385|mbtJ MVLRPITGAIPPDGPWGIWASRRIIAGLMGTFGPSLAGTRVEQVNSVLPDGRRVVGEWVYGPHNNAINAGPGGGAIYYVHGSGYTMCSPRTHRRLTSWLSSLTGLPVFSVDYRLAPRYRFPTAATDVRAAWDWLAHVCGLAAEHMVIAADSAGGHLTVDMLLQPEVAARPPAAVVLFSPLIDLTFRLGASRELQRPDPVVRADRAARSVALYYTGVDPAHHRLALDVAGGPPLPPTLIQVGGAEILEADARQLDADIRAAGGICELQVWPDQMHVFQALPRMTPEAAKAMTYVAQFIRSTTARGDL