PPE1 Family assigned · medium auto-curated
H37Rv Rv0096 · MTBC0 - ·
463 aa ·
105324–106715 H37Rv
(+) ·
RefSeq YP_177690.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | PPE family protein PPE1 |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | PPE family protein PPE1. Pfam: PPE (PF00823.26), PPE-PPW (PF18878.6). |
| Functional category (TubercuList) | PE/PPE |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
In the literature (TB corpus sweep) 6 publications
6 TB publications mention this gene. 6 publication(s) discuss this gene (7 in a M. tuberculosis context, 1 in other mycobacteria — M. marinum (1)).
| Publication | Date |
|---|---|
| Integrating genomic, transcriptomic, and phenotypic information to explore drug resistance in Mycobacterium tuberculosis sub-lineage 4.2.2.2. doi:10.1093/jambio/lxaf063 | 2025 |
| Diisonitrile Lipopeptides Mediate Resistance to Copper Starvation in Pathogenic Mycobacteria. doi:10.1128/mbio.02513-22 | 2022 |
| A Role for Mycobacterium tuberculosis Sigma Factor C in Copper Nutritional Immunity. doi:10.3390/ijms22042118 | 2021 |
| A new Mycobacterium tuberculosis smooth colony reduces growth inside human macrophages and represses PDIM Operon gene expression. Does an heterogeneous population exist in intracellular mycobacteria? doi:10.1016/j.micpath.2012.06.002 | 2012 |
| Mycobacterium tuberculosis persistence mutants identified by screening in isoniazid-treated mice. doi:10.1073/pnas.1003219107 | 2010 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Intrinsic disorder (sequence + structure) highly disordered
| Predicted disorder | 48% of residues (metapredict) · mean AlphaFold pLDDT 67.8 |
|---|---|
| Disordered regions | 2 IDR(s), longest 187 aa [158-181, 276-463] |
carries a substantial disordered region (210/463 residues); disorder is a property, not a function
A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).
Conditional expression context (iModulons)
Member of 1 independently-modulated gene set(s):
SigC (sigC).
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
CRISPRi vulnerability
Vulnerability index 0.56 (95% CI -1.67 to 3.87). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Function unknown |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb0099
· 99.8% identity |
|---|---|
| M. leprae |
ML1991
· 54.8% identity |
| M. marinum |
MMAR_0261
· 58.7% identity |
| M. orygis |
RJtmp_000105
· 100.0% identity |
| M. abscessus |
MAB_0669
· 50.4% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WI49
SwissProt · reviewed
· Inferred from homology
|
|---|---|
| UniProt name | Uncharacterized PPE family protein PPE1 |
UniProt still lists this protein as Uncharacterized PPE family protein PPE1; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
N Cell motility
|
|---|---|
| eggNOG description | PPE family |
| Orthologous group | COG5651 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.268 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 12 synonymous, 9 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Mycobacteriaceae
| M. canettii dN/dS (deep-divergence selection) |
0.149
· 20 consensus substitution(s) under purifying selection vs M. canettii (deep divergence; dN/dS=0.149) — a real, constrained gene predating the MTBC clonal expansion |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 20/53 (38%) · mean identity 69.7%
· 2/4 closest MTBAP relatives present in a subset of the genus (20/53 NTM; in 2 of the 4 closest MTBAP relatives) — partial/intermediate conservation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 1/13 non-Mycobacterium reference genomes (down to Mycobacteriaceae) · mean identity 60.9% detected in the sister family Mycobacteriaceae (M. abscessus) but not in the broader Corynebacteriales — a Mycobacteriaceae-restricted gene (single-genome rung: interpret with care) |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 34 in the ORF — 0 in the essential state, 0 growth-defect, 34 non-essential, 0 growth-advantage. Saturation 0.971, mean read count 115.848484848. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| fitness in mouse infection (in vivo) | -5.08 | 0.0 | required |
| fitness in mouse infection (in vivo) | -3.70 | 0.018 | required |
| fitness in mouse infection (in vivo) | -3.63 | 0.011 | required |
| fitness in mouse infection (in vivo) | -3.60 | 0.0096 | required |
| fitness in mouse infection (in vivo) | -3.60 | 0.014 | required |
| fitness in mouse infection (in vivo) | -3.55 | 0.0097 | required |
| fitness in mouse infection (in vivo) | -3.50 | 0.0 | required |
| fitness in mouse infection (in vivo) | -3.38 | 0.012 | required |
| fitness in mouse infection (in vivo) | -3.35 | 0.0 | required |
| fitness after prolonged in vitro passage (in vitro passage) | -3.26 | 0.0 | required |
| fitness in mouse infection (in vivo) | -3.26 | 0.0094 | required |
| fitness in mouse infection (in vivo) | -3.22 | 0.0 | required |
Conditional fitness of transposon-disruption mutants across 40 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 1 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 9.45 ppm · rank 2713/3519 (22.9th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Predicted localisation (DeepTMHMM + lipobox)
| Prediction | predicted membrane protein (1 TM helix) |
|---|---|
| DeepTMHMM class | TM |
| TM helices (DeepTMHMM) | 1 |
Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.
Physico-chemical properties (computed, ProtParam)
| Length | 463 aa |
|---|---|
| Molecular weight | 46.9 kDa |
| Theoretical pI | 4.72 |
| GRAVY | 0.289 (hydrophobic) |
| Aliphatic index | 92.0 |
| Aromaticity | 0.076 |
| Instability index | 35.3 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
PPE | PF00823.26 | 4.6e-59 | 1–162 | PPE family |
PPE-PPW | PF18878.6 | 6.3e-09 | 414–457 | PPE-PPW subfamily C-terminal region |
Genomic context (neighbours & predicted operon) operon of 6
| Upstream (5' on genome) | Rv0095c (- strand, 108 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv0097 (+ strand, 18 bp gap) |
| Predicted operon |
PPE1 · Rv0097 · fcoT · fadD10 · Rv0100 · nrp
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (4 TF) |
Rv0047c (activates) · Rv0324 (activates) · sigC (activates) · Rv3249c (activates)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: fcoT (fatty acyl CoA thioesterase FcoT), high confidence from genomic context alone (score 964 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0098 fcoT |
fatty acyl CoA thioesterase FcoT | 988 | 964 ctx | neighborhood:787 coexpression:839 textmining:696 |
Rv0097 |
oxidoreductase | 992 | 963 ctx | neighborhood:752 coexpression:857 textmining:801 |
Rv0101 nrp |
peptide synthetase Nrp | 993 | 959 ctx | neighborhood:719 coexpression:859 textmining:838 |
Rv0099 fadD10 |
fatty-acid--CoA ligase FadD10 | 979 | 959 ctx | neighborhood:719 coexpression:860 textmining:511 |
Rv0100 hyp |
hypothetical protein | 971 | 942 ctx | neighborhood:719 coexpression:802 textmining:536 |
Rv0095c hyp |
hypothetical protein | 657 | 561 ctx | neighborhood:557 |
Rv0102 |
integral membrane protein | 627 | 433 ctx | neighborhood:430 |
Rv1386 PE15 |
PE family protein PE15 | 775 | 62 | textmining:771 |
Rv0372c hyp |
hypothetical protein | 440 | 50 | textmining:435 |
Rv0109 PE_PGRS1 |
PE-PGRS family protein PE_PGRS1 | 803 | 41 | textmining:803 |
Rv2929 hyp |
hypothetical protein | 434 | 41 | textmining:434 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): PPE family protein PPE1
- Pfam (hmmscan --cut_ga): PPE PF00823.26 (E=5e-59), PPE-PPW PF18878.6 (E=6e-09)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177690.1)
- Domains: Pfam-A via hmmscan --cut_ga — PPE (PF00823.26), PPE-PPW (PF18878.6)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG5651 - Curated reference: UniProt P9WI49 (SwissProt, reviewed; Inferred from homology)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
11 functional partner(s); context anchor
fcoT - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv0096|PPE1 MAIPPEVHSGLLSAGCGPGSLLVAAQQWQELSDQYALACAELGQLLGEVQASSWQGTAATQYVAAHGPYLAWLEQTAINSAVTAAQHVAAAAAYCSALAAMPTPAELAANHAIHGVLIATNFFGINTVPIALNEADYVRMWLQAADTMAAYQAVADAATVAVPSTQPAPPIRAPGGDAADTRLDVLSSIGQLIRDILDFIANPYKYFLEFFEQFGFSPAVTVVLALVALQLYDFLWYPYYASYGLLLLPFFTPTLSALTALSALIHLLNLPPAGLLPIAAALGPGDQWGANLAVAVTPATAAVPGGSPPTSNPAPAAPSSNSVGSASAAPGISYAVPGLAPPGVSSGPKAGTKSPDTAADTLATAGAARPGLARAHRRKRSESGVGIRGYRDEFLDATATVDAATDVPAPANAAGSQGAGTLGFAGTAPTTSGAAAGMVQLSSHSTSTTVPLLPTTWTTDAEQ
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for PPE1? Email the maintainer — the message is pre-filled with this gene's details.