Rv1356c Resolved · high

H37Rv Rv1356c · MTBC0 - · 263 aa · 1524029–1524820 (-) · RefSeq NP_215872.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)TrzA: N-acyl amino acid transferase. N-acylates L-tryptophan (highest specificity for C5:0-CoA) in the trzAS cluster for N-acylated tryptazolone biosynthesis. RefSeq still annotates it hypothetical.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WM09 SwissProt · reviewed · Predicted
UniProt nameUncharacterized protein Rv1356c

UniProt still lists this protein as Uncharacterized protein Rv1356c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2C4J7

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.082 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 0 missense, 1 nonsense, 0 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.12% of strains (169) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 91.1 (very high). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
2g0b-assembly1_A 1.00 0.74 1.6e-05 sig 2g0b-assembly1_A The structure of FeeM, an N-acyl amino acid synthase from uncultured soil microbes
2g0b-assembly11_D 1.00 0.69 5.4e-06 sig 2g0b-assembly11_D The structure of FeeM, an N-acyl amino acid synthase from uncultured soil microbes
2g0b-assembly7_G 1.00 0.73 2.7e-05 sig 2g0b-assembly7_G The structure of FeeM, an N-acyl amino acid synthase from uncultured soil microbes
5w8a-assembly1_A 1.00 0.60 3.3e-06 sig 5w8a-assembly1_A The structure of a COA-dependent acyl-homoserine lactone synthase, BjaI, with SAM and isopentyl-CoA
6wns-assembly1_A 1.00 0.62 4.5e-06 sig 6wns-assembly1_A The structure of a CoA-dependent acyl-homoserine lactone synthase, MesI
2g0b-assembly8_H 1.00 0.70 3.6e-05 sig 2g0b-assembly8_H The structure of FeeM, an N-acyl amino acid synthase from uncultured soil microbes
2g0b-assembly10_B 1.00 0.66 2.0e-05 sig 2g0b-assembly10_B The structure of FeeM, an N-acyl amino acid synthase from uncultured soil microbes
1vhs-assembly2_B 1.00 0.65 1.5e-05 sig 1vhs-assembly2_B Crystal structure of a putative phosphinothricin N-acetyltransferase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: moeY (molybdopterin biosynthesis protein MoeY), high confidence from genomic context alone (score 967 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1354c hyp hypothetical protein 991 968 ctx neighborhood:811 coexpression:839 textmining:742
Rv1355c moeY molybdopterin biosynthesis protein MoeY 994 967 ctx neighborhood:773 coexpression:860 textmining:837
Rv1353c HTH-type transcriptional regulator 972 929 ctx neighborhood:732 coexpression:746 textmining:628
Rv1357c hyp hypothetical protein 864 864 coexpression:860
Rv1358 transcriptional regulator 846 846 coexpression:846
Rv0895 diacyglycerol O-acyltransferase 744 744 coexpression:744
Rv3114 hyp hypothetical protein 422 423 coexpression:423
Rv1638 uvrA excinuclease ABC subunit UvrA 455 55 textmining:447
Rv1633 uvrB excinuclease ABC subunit UvrB 550 47 textmining:548
Rv1625c cya adenylate cyclase 439 47 textmining:436
Rv1420 uvrC excinuclease ABC subunit UvrC 551 45 textmining:550
Rv3764c tcrY two component sensor kinase TcrY 513 45 textmining:511
Rv1163 narJ nitrate reductase subunit delta 510 41 textmining:510

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Foldseek: 2g0b-assembly1_A The structure of FeeM, an N-acyl amino acid synthase (E=2e-05, TM=0.74)
  • Experimentally characterised as TrzA by Kleetz et al. 2025

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215872.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2C4J7
  • Curated reference: UniProt P9WM09 (SwissProt, reviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 91.1, very high)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 13 functional partner(s); context anchor moeY
  • Primary literature: Kleetz J, et al. (2025). Characterization of TrzA, an N-acyl amino acid transferase from Mycobacterium tuberculosis Journal of Biological Chemistry. doi:10.1016/j.jbc.2025.111079

Ancestral MTBC0 protein sequence

>H37Rv|Rv1356c|
MLIAGYLTDWRIMTTAQLRPIAPQKLHFSENLSVWVSDAQCRLVVSQPALDPTLWNTYLQGALRAYSKHGVECTLDLDAISDGSDTQLFFAAIDIGGDVVGGARVIGPLRSADDSHAVVEWAGNPGLSAVRKMINDRAPFGVVEVKSGWVNSDAQRSDAIAAALARALPLSMSLLGVQFVMGTAAAHALDRWRSSGGVIAARIPAAAYPDERYRTKMIWWDRRTLANHAEPKQLSRMLVESRKLLRDVEALSATTAATAGAEQ