Rv1366A Still unknown · low auto-curated

H37Rv Rv1366A · MTBC0 - · 86 aa · 1539180–1539440 (+) · RefSeq YP_004837053.2

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Conserved hypothetical protein; no recognised domain. Function unknown. Foldseek best (non-significant) hit: 9erv-assembly1_A Structure of Salmonella CapRel bound to Bas11 Gp54 (prob 0.30, TM 0.40).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt V5QQR7 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2DS19

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.318 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 74.0 (confident). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
9erv-assembly1_A 0.30 0.40 2.8e-01 9erv-assembly1_A Structure of Salmonella CapRel bound to Bas11 Gp54
7x39-assembly1_A 0.12 0.48 2.2e+00 7x39-assembly1_A Structure of CIZ1 bound ERH
7ohx-assembly1_H 0.11 0.51 2.6e+00 7ohx-assembly1_H Nog1-TAP associated immature ribosomal particles from S. cerevisiae after rpL34 expression shut down, population A
3egr-assembly1_B-2 0.10 0.44 3.0e+00 3egr-assembly1_B-2 CRYSTAL STRUCTURE OF A PHENYLACETATE-COA OXYGENASE SUBUNIT PAAB (REUT_A2307) FROM RALSTONIA EUTROPHA JMP134 AT 2.65 A RESOLUTION
1ln0-assembly1_A 0.09 0.39 3.4e+00 1ln0-assembly1_A Structure of the Catalytic Domain of Homing Endonuclease I-TevI
4zfj-assembly3_I 0.07 0.46 4.2e+00 4zfj-assembly3_I Ergothioneine-biosynthetic Ntn hydrolase EgtC, apo form
4zfk-assembly1_A 0.06 0.46 6.2e+00 4zfk-assembly1_A Ergothioneine-biosynthetic Ntn hydrolase EgtC with glutamine
1mk0-assembly1_A 0.04 0.38 8.6e+00 1mk0-assembly1_A catalytic domain of intron endonuclease I-TevI, E75A mutant

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rsfA (anti-sigma-F factor antagonist RsfA), medium confidence from genomic context alone (score 496 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1366 hyp hypothetical protein 834 834 ctx neighborhood:834
Rv1365c rsfA anti-sigma-F factor antagonist RsfA 495 496 ctx neighborhood:496

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Foldseek best: 9erv-assembly1_A Structure of Salmonella CapRel bound to Bas11 Gp54 (prob 0.30, E=3e-01, TM=0.40)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_004837053.2)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2DS19
  • Curated reference: UniProt V5QQR7 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 74.0, confident)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 2 functional partner(s); context anchor rsfA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv1366A|
MRPSRQGEVGEVAGYVVEYNRRTHVRRITEFATPQEAMEHRLKLEAERTDSNIEIVALVSKSLGTLKQTHSRYFTGEELNVGNGAR