Rv1118c Resolved · high
H37Rv Rv1118c · MTBC0 - ·
286 aa ·
1241971–1242831 H37Rv
(-) ·
RefSeq NP_215634.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Circularly permuted NlpC/P60 (YaeF/YiiX-family) cysteine amidase with a structurally competent Cys234-His97 catalytic dyad (Glu115 a candidate third member). RefSeq leaves this locus 'hypothetical protein'; here it is re-annotated by structure-guided active-site mapping. The catalytic histidine partner of the nucleophile Cys234 is His97 (Sgamma-Ndelta1 = 3.6 A on the ESMFold model, 2.9 A on AlphaFold3), invisible to sequence proximity because the fold is circularly permuted - the three sequence-proximal histidines lie 7-23 A away. HHpred matches the permuted Peptidase_C92 / YaeF-YiiX family (>=99.7%) and lipid-acting permuted members (LRAT, H-REV107), and the 86%-hydrophobic pocket points to an N-acyl-amino-acid / lipoprotein amide substrate rather than a peptidoglycan muropeptide. Distinct from the five canonical peptidoglycan-hydrolase NlpC/P60 enzymes of H37Rv (Rv0024, RipA, RipB, RipD, Rv2190c). Catalytic codons essentially invariant across ~250,724 MTBC genomes. A structural prediction, not a biochemical assay. |
| Functional category (TubercuList) | conserved hypotheticals |
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
In the literature (TB corpus sweep) never studied
No publication in PubMed mentions this gene in its title or abstract — not under its H37Rv locus tag, nor under any of its ortholog identifiers (M. bovis, M. marinum, M. smegmatis, M. leprae, M. abscessus). The atlas annotation rests on sequence/structure evidence, not on a primary study of this gene.
A verified absence of literature is itself information: it flags an annotation with no primary study behind it. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole), MULTI-ALIAS sweep: H37Rv locus tag AND every ortholog identifier (M. bovis Mb…, M. marinum MMAR_…, M. smegmatis MSMEG_…, M. leprae ML…, M. abscessus MAB_…), each hit VERIFIED against the abstract text (word-boundary regex). phase73/phase75, 2026-07-13.
Intrinsic disorder (sequence + structure) partially disordered
| Predicted disorder | 15% of residues (metapredict) · mean AlphaFold pLDDT 74.1 |
|---|---|
| Disordered regions | 1 IDR(s), longest 43 aa [0-43] |
carries a substantial disordered region (43/286 residues); disorder is a property, not a function
A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).
CRISPRi vulnerability
Vulnerability index 1.25 (95% CI -0.70 to 4.53). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser) ahead of Mycobrowser
| Mycobrowser function | Function unknown |
|---|
Mycobrowser classes this locus among conserved hypotheticals; the atlas now assigns a functional handle (requalified function). Mycobrowser is no longer maintained, so its EC numbers predate recent nomenclature revisions (e.g. the 2018 EC 7 "translocase" class) — most EC differences are re-numberings of the same enzyme, not conflicts.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb1149c
· 99.7% identity |
|---|---|
| M. marinum |
MMAR_4342
· 78.4% identity |
| M. smegmatis |
MSMEG_5213
· 74.0% identity |
| M. orygis |
RJtmp_001180
· 100.0% identity |
| M. abscessus |
MAB_1591
· 68.7% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
O06570
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Conserved protein |
UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| Orthologous group | 28P5T |
|---|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains) pseudogene candidate
| pN/pS | 0.518 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 5 missense, 1 nonsense, 1 frameshift |
| Disruption | 2 distinct premature-stop/frameshift site(s); most common in 1.05% of strains (1530) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Corynebacteriales
| M. canettii dN/dS (deep-divergence selection) |
0.277
· 10 consensus substitution(s) under purifying selection vs M. canettii (deep divergence; dN/dS=0.277) — a real, constrained gene predating the MTBC clonal expansion |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 75.5%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 4/13 non-Mycobacterium reference genomes (down to Corynebacteriales) · mean identity 58.4% detected across the order Corynebacteriales (Corynebacterium/Nocardia/Rhodococcus/…) but not in more distant Actinomycetia — a Corynebacteriales-level gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 12 in the ORF — 0 in the essential state, 0 growth-defect, 12 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 175.5. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 11 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 44.2 ppm · rank 1836/3519 (47.9th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 286 aa |
|---|---|
| Molecular weight | 32.2 kDa |
| Theoretical pI | 9.46 |
| GRAVY | -0.553 (hydrophilic) |
| Aliphatic index | 81.5 |
| Aromaticity | 0.066 |
| Instability index | 28.8 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Structural neighbours (Foldseek on the ESMFold model, exploratory)
ESMFold model confidence: mean pLDDT 84.6 (confident). A confident model makes the fold comparison meaningful.
Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.
| Target | Prob | TM | E-value | Description |
|---|---|---|---|---|
3kw0-assembly1_B |
1.00 | 0.68 | 4.0e-06 sig | 3kw0-assembly1_B Crystal structure of Cysteine peptidase (NP_982244.1) from BACILLUS CEREUS ATCC 10987 at 2.50 A resolution |
3kw0-assembly1_C |
1.00 | 0.67 | 4.0e-06 sig | 3kw0-assembly1_C Crystal structure of Cysteine peptidase (NP_982244.1) from BACILLUS CEREUS ATCC 10987 at 2.50 A resolution |
3kw0-assembly1_A |
1.00 | 0.67 | 1.9e-05 sig | 3kw0-assembly1_A Crystal structure of Cysteine peptidase (NP_982244.1) from BACILLUS CEREUS ATCC 10987 at 2.50 A resolution |
3kw0-assembly1_D |
1.00 | 0.64 | 2.6e-05 sig | 3kw0-assembly1_D Crystal structure of Cysteine peptidase (NP_982244.1) from BACILLUS CEREUS ATCC 10987 at 2.50 A resolution |
2if6-assembly2_B |
1.00 | 0.58 | 9.4e-05 sig | 2if6-assembly2_B Crystal structure of metalloprotein yiiX from Escherichia coli O157:H7, DUF1105 |
6z1p-assembly1_At |
0.02 | 0.15 | 1.6e+00 | 6z1p-assembly1_At Structure of the mitochondrial ribosome from Tetrahymena thermophila |
5a5k-assembly4_D |
0.01 | 0.23 | 9.0e+00 | 5a5k-assembly4_D AtGSTF2 from Arabidopsis thaliana in complex with camalexin |
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 74.1
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
3kw0-assembly1_D |
1.00 | 0.65 | 9.0e-06 sig | 3kw0-assembly1_D Crystal structure of Cysteine peptidase (NP_982244.1) from BACILLUS CEREUS ATCC 10987 at 2.50 A resolution |
3kw0-assembly1_B |
1.00 | 0.63 | 8.0e-06 sig | 3kw0-assembly1_B Crystal structure of Cysteine peptidase (NP_982244.1) from BACILLUS CEREUS ATCC 10987 at 2.50 A resolution |
3kw0-assembly1_C |
1.00 | 0.62 | 7.5e-06 sig | 3kw0-assembly1_C Crystal structure of Cysteine peptidase (NP_982244.1) from BACILLUS CEREUS ATCC 10987 at 2.50 A resolution |
3kw0-assembly1_A |
1.00 | 0.65 | 1.2e-05 sig | 3kw0-assembly1_A Crystal structure of Cysteine peptidase (NP_982244.1) from BACILLUS CEREUS ATCC 10987 at 2.50 A resolution |
Foldseek search of the AlphaFold DB model (mean pLDDT 74.1, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 3
| Upstream (5' on genome) | Rv1117 (+ strand, 14 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv1119c (- strand, 32 bp gap) |
| Predicted operon |
Rv1118c · Rv1119c · Rv1120c
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: lppW (lipoprotein LppW), medium confidence from genomic context alone (score 521 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1119c hyp |
hypothetical protein | 744 | 744 ctx | neighborhood:710 |
Rv1120c hyp |
hypothetical protein | 743 | 743 ctx | neighborhood:710 |
Rv2905 lppW |
lipoprotein LppW | 520 | 521 ctx | cooccurence:518 |
Rv2027c dosT |
two component sensor histidine kinase DosT | 533 | 485 | |
Rv3132c devS |
two component sensor histidine kinase DevS | 532 | 484 | |
Rv0845 narS |
sensor histidine kinase NarS | 490 | 467 | |
Rv0941c hyp |
hypothetical protein | 460 | 460 ctx | cooccurence:457 |
Rv1121 zwf1 |
glucose-6-phosphate 1-dehydrogenase | 442 | 443 ctx | neighborhood:441 |
Rv1122 gnd2 |
6-phosphogluconate dehydrogenase (decarboxylating) | 411 | 412 ctx | neighborhood:408 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- RefSeq: hypothetical protein
- Active-site mapping: catalytic dyad Cys234-His97 (Sgamma-Ndelta1 3.6 A ESMFold / 2.9 A AlphaFold3); circularly permuted topology
- HHpred: permuted Peptidase_C92 / YaeF-YiiX family >=99.7%; lipid-acting permuted members (LRAT, H-REV107)
- Hydrophobic pocket (86%) -> N-acyl-amino-acid / lipoprotein amide substrate, not peptidoglycan
- Distinct from the 5 canonical peptidoglycan-hydrolase NlpC/P60 enzymes of H37Rv
- Catalytic codons invariant across ~250,724 MTBC genomes (purifying selection)
- Curated against the companion dark-enzymes re-annotation (Guyeux 2026)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215634.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
28P5T - Curated reference: UniProt O06570 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Model confidence: ESMFold per-residue pLDDT (mean 84.6, confident)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 74.1)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
9 functional partner(s); context anchor
lppW - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: Guyeux C (2026). Structure-guided functional hypotheses for uncharacterised enzymes of Mycobacterium tuberculosis in preparation. doi:10.5281/zenodo.20571950
Ancestral MTBC0 protein sequence
>H37Rv|Rv1118c| MQSGPHLVGRVGTSFPLIARHQGATRDDAGDTGQPDPLPHVAHPDRLYPPMVHGVDPSTLALDRALNETRTGDLWLFRGRSRPDRAIQTLTNAPVNHVGMTVAIDDLPPLIWHAELGDKLLDVWTGTNHRGVQLNDARQVVQQWAGRYRQRCWLRQLTPHANRDQEDKLLRVIARMNGTPFPTTARLTGRWLRGRLPTLNDWLRGIPVLDRKVREQTQRRKQQQRTMGLATAYCAETVAITYEEMGLLVTDKDAHWFDPGKFWSGDSLPLAPGYRLGHEIAVDVGG
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for Rv1118c? Email the maintainer — the message is pre-filled with this gene's details.