kdpF Resolved · high auto-curated
H37Rv Rv1028A · MTBC0 - ·
30 aa ·
1151920–1152012 H37Rv
(+) ·
RefSeq YP_177636.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | membrane protein KdpF |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Membrane protein KdpF. Pfam: Potass_KdpF (PF09604.16). |
| Functional category (TubercuList) | cell wall and cell processes |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
In the literature (TB corpus sweep) 8 publications
8 TB publications mention this gene. 8 publication(s) discuss this gene (7 in a M. tuberculosis context, 3 in other mycobacteria — M. smegmatis (2), M. leprae (1)).
| Publication | Date |
|---|---|
| Rv2617c and P36 are virulence factors of pathogenic mycobacteria involved in resistance to oxidative stress. doi:10.1080/21505594.2019.1693714 | 2019 |
| Regulation of Inducible Potassium Transporter KdpFABC by the KdpD/KdpE Two-Component System in Mycobacterium smegmatis. doi:10.3389/fmicb.2017.00570 | 2017 |
| Endogenous and Exogenous KdpF Peptide Increases Susceptibility of Mycobacterium bovis BCG to Nitrosative Stress and Reduces Intramacrophage Replication. doi:10.3389/fcimb.2017.00115 | 2017 |
| Overexpression of the Salmonella KdpF membrane peptide modulates expression of kdp genes and intramacrophage growth. doi:10.1111/1574-6968.12559 | 2014 |
| Overexpression of the KdpF membrane peptide in Mycobacterium bovis BCG results in reduced intramacrophage growth and altered cording morphology. doi:10.1371/journal.pone.0060379 | 2013 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene
| Neighbour | kdpA (Rv1029, + strand) |
|---|---|
| Overlap | 1 bp, 1 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
Conditional expression context (iModulons)
Member of 1 independently-modulated gene set(s):
SG_11.
iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).
CRISPRi vulnerability
Vulnerability index 0.69 (95% CI -1.85 to 3.42). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Thought to be involved in stabilization of the KDP complex. |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb1057
· 100.0% identity |
|---|---|
| M. orygis |
RJtmp_001089
· 100.0% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
Q79FT7
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | Probable membrane protein KdpF |
Outgroup conservation (beyond the MTBC) MTBC-specific
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 0/53 (0%)
· 0/4 closest MTBAP relatives absent from ALL 53 non-MTBC Mycobacterium genomes tested (incl. the closest MTBAP relatives) — a candidate MTBC-specific genetic innovation / host-adaptation factor (confirm by synteny; rule out a short/low-complexity ORF and extreme divergence) |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria short ORF (30 aa) a shallow stratum may reflect homology-detection failure, not true youth absent from the whole genus and from all outgroups tested — a candidate MTBC-specific innovation (confirm by synteny; rule out detection failure for short/divergent ORFs) |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 3 in the ORF — 0 in the essential state, 0 growth-defect, 3 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 26. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Statistically thin call: only 3 TA (Himar1) sites in the whole ORF (atlas median 13; genes under 300 nt typically have very few). A DeJesus 2017 call built on so few independent observations is less robust than the same call on a longer gene, in either direction. Cross-check against the CRISPRi vulnerability index (independent of TA-site density) and, if this gene overlaps a neighbour (see Genomic-neighbour overlap section below), verify how many of its TA sites actually fall inside its own ORF. (P20.3) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) not detected
Not detected in the mass-spectrometry datasets integrated by PaxDb. This is not evidence of absence: low-abundance, condition-specific, or MS-refractory proteins (e.g. small, highly hydrophobic, or repetitive PE/PPE families with few tryptic peptides) are systematically under-sampled.
Predicted localisation (DeepTMHMM + lipobox)
| Prediction | predicted membrane protein (1 TM helix) |
|---|---|
| DeepTMHMM class | TM |
| TM helices (DeepTMHMM) | 1 |
Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.
Physico-chemical properties (computed, ProtParam)
| Length | 30 aa |
|---|---|
| Molecular weight | 3.3 kDa |
| Theoretical pI | 4.37 |
| GRAVY | 1.7 (hydrophobic) |
| Aliphatic index | 146.3 |
| Aromaticity | 0.133 |
| Instability index | 29.0 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Potass_KdpF | PF09604.16 | 9.0e-09 | 7–30 | F subunit of K+-transporting ATPase (Potass_KdpF) |
Genomic context (neighbours & predicted operon) operon of 4
| Upstream (5' on genome) | kdpD (- strand, 233 bp gap) |
|---|---|
| Downstream (3' on genome) | kdpA (+ strand, -1 bp gap) |
| Predicted operon |
kdpF · kdpA · kdpB · kdpC
|
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: kdpA (potassium-transporting ATPase subunit A), high confidence from genomic context alone (score 883 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1029 kdpA |
potassium-transporting ATPase subunit A | 944 | 883 ctx | neighborhood:882 textmining:541 |
Rv1030 kdpB |
potassium-transporting ATPase subunit B | 962 | 819 ctx | neighborhood:818 textmining:803 |
Rv1031 kdpC |
potassium-transporting ATPase subunit C | 917 | 819 ctx | neighborhood:818 textmining:562 |
Rv1027c kdpE |
transcriptional regulator KdpE | 667 | 528 ctx | neighborhood:528 |
Rv1028c kdpD |
sensor protein KdpD | 815 | 488 ctx | neighborhood:485 textmining:653 |
Rv1690 lprJ |
lipoprotein LprJ | 545 | 50 | textmining:541 |
Rv1625c cya |
adenylate cyclase | 434 | 44 | textmining:433 |
Rv2212 |
adenylyl cyclase | 546 | 42 | textmining:546 |
Rv1368 lprF |
lipoprotein LprF | 440 | 42 | textmining:440 |
Rv0900 arfB |
membrane protein | 809 | 41 | textmining:809 |
Rv1647 |
adenylate cyclase | 547 | 41 | textmining:547 |
Rv1318c |
adenylate cyclase | 518 | 41 | textmining:518 |
Rv1320c |
adenylate cyclase | 514 | 41 | textmining:514 |
Rv1264 |
adenylyl cyclase | 511 | 41 | textmining:511 |
Rv1319c |
adenylate cyclase | 511 | 41 | textmining:511 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): membrane protein KdpF
- Pfam (hmmscan --cut_ga): Potass_KdpF PF09604.16 (E=9e-09)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177636.1)
- Domains: Pfam-A via hmmscan --cut_ga — Potass_KdpF (PF09604.16)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Curated reference: UniProt Q79FT7 (TrEMBL, unreviewed; Predicted)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
16 functional partner(s); context anchor
kdpA - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv1028A|kdpF MTTVDNIVGLVIAVALMAFLFAALLFPEKF
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for kdpF? Email the maintainer — the message is pre-filled with this gene's details.