kdpF Resolved · high auto-curated
H37Rv Rv1028A · MTBC0 - ·
30 aa · 1151920–1152012 (+) ·
RefSeq YP_177636.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | membrane protein KdpF |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Membrane protein KdpF. Pfam: Potass_KdpF (PF09604.16). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
Q79FT7
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | Probable membrane protein KdpF |
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Potass_KdpF | PF09604.16 | 9.0e-09 | 7–30 | F subunit of K+-transporting ATPase (Potass_KdpF) |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: kdpA (potassium-transporting ATPase subunit A), high confidence from genomic context alone (score 883 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1029 kdpA |
potassium-transporting ATPase subunit A | 944 | 883 ctx | neighborhood:882 textmining:541 |
Rv1030 kdpB |
potassium-transporting ATPase subunit B | 962 | 819 ctx | neighborhood:818 textmining:803 |
Rv1031 kdpC |
potassium-transporting ATPase subunit C | 917 | 819 ctx | neighborhood:818 textmining:562 |
Rv1027c kdpE |
transcriptional regulator KdpE | 667 | 528 ctx | neighborhood:528 |
Rv1028c kdpD |
sensor protein KdpD | 815 | 488 ctx | neighborhood:485 textmining:653 |
Rv1690 lprJ |
lipoprotein LprJ | 545 | 50 | textmining:541 |
Rv1625c cya |
adenylate cyclase | 434 | 44 | textmining:433 |
Rv2212 |
adenylyl cyclase | 546 | 42 | textmining:546 |
Rv1368 lprF |
lipoprotein LprF | 440 | 42 | textmining:440 |
Rv0900 arfB |
membrane protein | 809 | 41 | textmining:809 |
Rv1647 |
adenylate cyclase | 547 | 41 | textmining:547 |
Rv1318c |
adenylate cyclase | 518 | 41 | textmining:518 |
Rv1320c |
adenylate cyclase | 514 | 41 | textmining:514 |
Rv1264 |
adenylyl cyclase | 511 | 41 | textmining:511 |
Rv1319c |
adenylate cyclase | 511 | 41 | textmining:511 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): membrane protein KdpF
- Pfam (hmmscan --cut_ga): Potass_KdpF PF09604.16 (E=9e-09)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177636.1)
- Domains: Pfam-A via hmmscan --cut_ga — Potass_KdpF (PF09604.16)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Curated reference: UniProt Q79FT7 (TrEMBL, unreviewed; Predicted)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
16 functional partner(s); context anchor
kdpA - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv1028A|kdpF MTTVDNIVGLVIAVALMAFLFAALLFPEKF