kdpF Resolved · high auto-curated

H37Rv Rv1028A · MTBC0 - · 30 aa · 1151920–1152012 (+) · RefSeq YP_177636.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)membrane protein KdpF
MTBC0 PGAP re-annotation
Revised (this work)Membrane protein KdpF. Pfam: Potass_KdpF (PF09604.16).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt Q79FT7 TrEMBL · unreviewed · Predicted
UniProt nameProbable membrane protein KdpF

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Potass_KdpFPF09604.16 9.0e-097–30 F subunit of K+-transporting ATPase (Potass_KdpF)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: kdpA (potassium-transporting ATPase subunit A), high confidence from genomic context alone (score 883 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1029 kdpA potassium-transporting ATPase subunit A 944 883 ctx neighborhood:882 textmining:541
Rv1030 kdpB potassium-transporting ATPase subunit B 962 819 ctx neighborhood:818 textmining:803
Rv1031 kdpC potassium-transporting ATPase subunit C 917 819 ctx neighborhood:818 textmining:562
Rv1027c kdpE transcriptional regulator KdpE 667 528 ctx neighborhood:528
Rv1028c kdpD sensor protein KdpD 815 488 ctx neighborhood:485 textmining:653
Rv1690 lprJ lipoprotein LprJ 545 50 textmining:541
Rv1625c cya adenylate cyclase 434 44 textmining:433
Rv2212 adenylyl cyclase 546 42 textmining:546
Rv1368 lprF lipoprotein LprF 440 42 textmining:440
Rv0900 arfB membrane protein 809 41 textmining:809
Rv1647 adenylate cyclase 547 41 textmining:547
Rv1318c adenylate cyclase 518 41 textmining:518
Rv1320c adenylate cyclase 514 41 textmining:514
Rv1264 adenylyl cyclase 511 41 textmining:511
Rv1319c adenylate cyclase 511 41 textmining:511

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): membrane protein KdpF
  • Pfam (hmmscan --cut_ga): Potass_KdpF PF09604.16 (E=9e-09)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177636.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Potass_KdpF (PF09604.16)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Curated reference: UniProt Q79FT7 (TrEMBL, unreviewed; Predicted)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 16 functional partner(s); context anchor kdpA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv1028A|kdpF
MTTVDNIVGLVIAVALMAFLFAALLFPEKF