cysK2 Resolved · high auto-curated

H37Rv Rv0848 · MTBC0 - · 372 aa · 944938–946056 (+) · RefSeq YP_177762.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)cysteine synthase CysK
MTBC0 PGAP re-annotation
Revised (this work)Cysteine synthase CysK. Pfam: PALP (PF00291.32).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt Q79FV4 SwissProt · reviewed · Evidence at protein level
UniProt nameS-sulfocysteine synthase
EC (curated) EC 2.5.1.65, EC 2.8.5.1
Curated functionCatalyzes the synthesis of S-sulfocysteine, utilizing O-phosphoserine (OPS) and thiosulfate as substrates. To a lesser extent, can also use sulfide as donor substrate, producing L-cysteine. CysK2 thus provides a third metabolic route to cysteine, either directly using sulfide as donor or indirectly via S-sulfocysteine. S-sulfocysteine might also act as a signaling molecule triggering additional responses in redox defense in the pathogen upon exposure to reactive oxygen species during intracellular survival or dormancy. Cannot utilize thiocarboxylated CysO as a sulfur donor and O-acetylserine (.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
Preferred namecysK2
eggNOG descriptionPFAM Pyridoxal-5'-phosphate-dependent enzyme, beta subunit
Orthologous groupCOG0031
EC number EC 2.5.1.47
KEGG orthology K01738
KEGG pathways map00270, map00920, map01100, map01110, map01120, map01130, map01200, map01230
KEGG modules M00021
Gene Ontology (69) GO:0000096, GO:0000097, GO:0003674, GO:0003824, GO:0004124, GO:0005488, GO:0005515, GO:0005575, GO:0005618, GO:0005622, GO:0005623, GO:0005737 +57 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 1.415 · diversifying/relaxed
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 8 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.19% of strains (283) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PALPPF00291.32 3.7e-5231–315 Pyridoxal-phosphate dependent enzyme

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0849 (MFS-type transporter), high confidence from genomic context alone (score 995 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0849 MFS-type transporter 999 995 ctx neighborhood:881 cooccurence:735 coexpression:862 textmining:810
Rv0850 Rv0850, (MTV043.43), len: 110 aa. Putative transposase (fragment), similar in part to others e.g. Q45144|Q4514 transposable element IS31831 994 962 ctx neighborhood:801 coexpression:819 textmining:860
Rv3684 lyase 936 937 database:900
Rv2334 cysK1 O-acetylserine sulfhydrylase 944 926 database:900
Rv0884c serC phosphoserine aminotransferase 913 906 database:900
Rv0847 lpqS lipoprotein LpqS 964 901 ctx neighborhood:512 coexpression:806 textmining:652
Rv0846c mmcO oxidase 951 901 coexpression:846 textmining:534
Rv2963 integral membrane protein 880 841 coexpression:841
Rv1286 cysC adenylyl-sulfate kinase 908 785 coexpression:756 textmining:590
Rv2335 cysE serine acetyltransferase 837 750 coexpression:475
Rv1079 metB cystathionine gamma-synthase 650 613 coexpression:464
Rv0391 metZ O-succinylhomoserine sulfhydrylase 592 551 coexpression:467
Rv2398c cysW sulfate ABC transporter permease CysW 748 431 coexpression:412 textmining:576
Rv1285 cysD sulfate adenylyltransferase subunit 2 555 428 coexpression:409
Rv2397c cysA1 sulfate ABC transporter ATP-binding protein CysA 461 428 coexpression:410

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): cysteine synthase CysK
  • Pfam (hmmscan --cut_ga): PALP PF00291.32 (E=4e-52)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177762.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PALP (PF00291.32)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0031
  • Curated reference: UniProt Q79FV4 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 42 functional partner(s); context anchor Rv0849
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0848|cysK2
MRSRQTRDRYRLLPEGYQVTPGRNRHPGTMVGNTPVLWIPELSGTSDPDRGFWAKLEGFNPGGMKDRPALYMVECARARGDIAPGAAIVESTGGTLGLGLALAGKVYRHPVTLVTDPGLEPIIARMLTAYGAGVDMVTQPHPVGGWQQARKDRVAQLMAEYPGAWNPNQYGNPDNVGAYRSLALELVAQLGRIDVLVCSVGTGGHSAGVARVLREFNPDMRLIGVDTIGSTIFGQPASNRLMRGLGSSIYPRNVDYRAFDEVHWVAPPEAVWACRSLAATHYASGGWSVGAVALVAGWAARNLPADTTIAAVFPDGPQRYFDTIYNDAYCNEHELLGGQPPTEPDEIASPLDAVVTRWTRSTTVIDPTQVVS